close

SimulationCraft 801-02

for World of Warcraft 8.1.0 PTR (wow build level 28085)

Current simulator hotfixes

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Current simulator-wide DBC data overrides

Spell / Effect Field Override Value DBC Value
Deathbolt (effect#2) base_value 25.00 30.00
Drain Soul (effect#1) sp_coefficient 0.21 0.15
Nightfall rppm 4.00 3.00
Nightfall (effect#2) base_value 80.00 25.00
Soul Conduit (effect#1) base_value 20.00 15.00
Creeping Death (effect#1) base_value -20.00 -15.00
Creeping Death (effect#2) base_value -20.00 -15.00
Dark Soul: Misery (effect#1) base_value 25.00 30.00
Eye Beam (effect#1) sp_coefficient 0.26 0.32
Grimoire of Sacrifice (effect#1) sp_coefficient 0.48 0.35
Shadow Embrace duration 15000.00 10000.00
Affliction Warlock (effect#3) base_value 25.00 0.00
Affliction Warlock (effect#1) base_value 25.00 25.00
Affliction Warlock (effect#2) base_value 25.00 25.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Deathbolt : 17043 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17043.0 17043.0 5.5 / 0.032% 1725.6 / 10.1% 14.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
935.5 925.7 Mana 0.00% 46.1 100.0% 100%
Talents
  • 15: Deathbolt (Affliction Warlock)
  • 30: Siphon Life (Affliction Warlock)
  • 60: Phantom Singularity
  • 90: Haunt (Affliction Warlock)
  • 100: Dark Soul: Misery (Affliction Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Deathbolt 17043
Agony 1472 8.7% 17.0 17.48sec 25927 21422 Periodic 192.2 1972 3944 2296 16.4% 99.6%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.03 0.00 192.25 192.25 1.2103 1.5545 441421.54 441421.54 0.00 1381.81 21421.99
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 160.6 83.56% 1971.88 1 3075 1971.37 1909 2034 316756 316756 0.00
crit 31.6 16.44% 3943.93 2 6150 3942.95 3448 4415 124666 124666 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=gcd+action.shadow_bolt.execute_time&target.time_to_die>8
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.008000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Corruption 1669 9.8% 20.8 14.30sec 24071 19989 Periodic 190.5 2256 4513 2628 16.5% 98.4%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.80 0.00 190.50 190.50 1.2043 1.5501 500650.54 500650.54 0.00 1562.82 19989.24
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 159.1 83.53% 2256.47 1 3459 2256.39 2192 2324 359070 359070 0.00
crit 31.4 16.47% 4513.03 2 6919 4512.89 4010 4922 141581 141581 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.090000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Deathbolt 1111 6.5% 9.9 30.77sec 33374 28802 Direct 9.9 28750 57384 33503 16.6%  

Stats details: deathbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.95 9.91 0.00 0.00 1.1589 0.0000 332056.01 332056.01 0.00 28801.81 28801.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.27 83.40% 28750.23 807 77077 28874.12 14618 50747 237650 237650 0.00
crit 1.65 16.60% 57384.18 5741 152389 47760.31 0 149346 94406 94406 0.00
 
 

Action details: deathbolt

Static Values
  • id:264106
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.summon_darkglare.remains&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up
Spelldata
  • id:264106
  • name:Deathbolt
  • school:shadow
  • tooltip:
  • description:Launches a bolt of death at the target, dealing {$s2=30}% of the total remaining damage of your damage over time effects on the target.{$?s196103=false}[ Counts up to {$s3=14} sec of your Corruption's damage.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:22041.11
  • base_dd_max:22041.11
  • base_dd_mult:1.00
 
Haunt 528 3.1% 17.4 16.78sec 9084 7545 Direct 18.4 7402 14811 8620 16.4%  

Stats details: haunt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.42 18.36 0.00 0.00 1.2040 0.0000 158267.80 158267.80 0.00 7545.18 7545.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.34 83.57% 7401.97 6235 10906 7401.14 6935 7944 113578 113578 0.00
crit 3.02 16.43% 14810.66 12470 21164 14216.09 0 21164 44690 44690 0.00
 
 

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:48181
  • name:Haunt
  • school:shadow
  • tooltip:Taking {$s2=10}% increased damage from the Warlock. Haunt's cooldown will be reset on death.
  • description:A ghostly soul haunts the target, dealing {$s1=0} Shadow damage and increasing your damage dealt to the target by {$s2=10}% for {$d=15 seconds}. If the target dies, Haunt's cooldown is reset.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25
 
Heed My Call 159 (227) 0.9% (1.3%) 7.1 37.94sec 9653 0 Direct 7.1 5802 11614 6756 16.4%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.05 7.05 0.00 0.00 0.0000 0.0000 47661.50 47661.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.90 83.59% 5802.23 4925 6141 5796.33 0 6141 34214 34214 0.00
crit 1.16 16.41% 11613.59 9849 12282 8054.38 0 12282 13448 13448 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 68 0.4% 7.1 37.94sec 2897 0 Direct 7.1 2487 4974 2897 16.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.05 7.05 0.00 0.00 0.0000 0.0000 20434.61 20434.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.89 83.53% 2487.03 2111 2632 2486.02 0 2632 14655 14655 0.00
crit 1.16 16.47% 4973.63 4221 5264 3438.08 0 5264 5780 5780 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
  • base_dd_mult:1.00
 
Phantom Singularity 1105 6.5% 6.8 45.62sec 48885 39882 Periodic 70.4 4695 0 4695 0.0% 34.7%

Stats details: phantom_singularity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.76 0.00 70.39 70.39 1.2259 1.4785 330503.83 330503.83 0.00 2941.52 39882.21
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.4 100.00% 4695.42 4 6919 4696.38 4437 4965 330504 330504 0.00
 
 

Action details: phantom_singularity

Static Values
  • id:205179
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time>35&(cooldown.summon_darkglare.remains>=45|cooldown.summon_darkglare.remains<8)&target.time_to_die>16*spell_haste
Spelldata
  • id:205179
  • name:Phantom Singularity
  • school:shadow
  • tooltip:Dealing damage to all nearby targets every $t1 sec and healing the casting Warlock.
  • description:Places a phantom singularity above the target, which consumes the life of all enemies within $205246A2 yards, dealing ${8*{$205246s2=0 + 18.0%}} damage over {$d=16 seconds}, healing you for ${$205246e2*100}% of the damage done.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 

Action details: phantom_singularity_tick

Static Values
  • id:205246
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205246
  • name:Phantom Singularity
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205179=Places a phantom singularity above the target, which consumes the life of all enemies within $205246A2 yards, dealing ${8*{$205246s2=0 + 18.0%}} damage over {$d=16 seconds}, healing you for ${$205246e2*100}% of the damage done.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.180000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25
 
Shadow Bolt 2384 14.0% 91.0 3.19sec 7849 5073 Direct 90.3 6793 13591 7912 16.5%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.04 90.31 0.00 0.00 1.5472 0.0000 714510.33 714510.33 0.00 5072.85 5072.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.45 83.54% 6792.94 5189 8854 6793.59 6603 6978 512516 512516 0.00
crit 14.86 16.46% 13591.01 10378 17569 13591.99 12055 15534 201994 201994 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:232670
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.haunt.enabled&spell_targets.seed_of_corruption_aoe<3
Spelldata
  • id:232670
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25
 
Siphon Life 1489 8.8% 19.3 15.55sec 23200 19310 Periodic 127.5 3009 6018 3503 16.4% 98.9%

Stats details: siphon_life

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.25 0.00 127.50 127.50 1.2015 2.3278 446632.62 446632.62 0.00 1396.05 19309.67
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.6 83.57% 3008.61 1 4613 3008.42 2903 3096 320568 320568 0.00
crit 20.9 16.43% 6017.80 2 9225 6017.60 5098 6668 126065 126065 0.00
 
 

Action details: siphon_life

Static Values
  • id:63106
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.corruption.remains%dot.corruption.duration)&dot.siphon_life.remains<dot.siphon_life.duration*1.3
Spelldata
  • id:63106
  • name:Siphon Life
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and siphoning life to the casting Warlock.
  • description:Siphons the target's life essence, dealing $o1 Shadow damage over {$d=15 seconds} and healing you for ${$e1*100}% of the damage done.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.120000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Unstable Affliction 0 (3665) 0.0% (21.5%) 38.1 7.80sec 28725 25031

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.14 0.00 0.00 0.00 1.1476 0.0000 0.00 0.00 0.00 25031.10 25031.10
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
 
    Unstable Affliction (_1) 1979 11.7% 0.0 0.00sec 0 0 Periodic 124.8 4092 8184 4766 16.5% 67.5%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 124.83 124.83 0.0000 1.6216 595017.84 595017.84 0.00 2939.42 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.3 83.52% 4092.03 3239 6150 4092.43 3983 4241 426637 426637 0.00
crit 20.6 16.48% 8183.95 6478 12300 8184.15 7498 9413 168381 168381 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 763 4.5% 0.0 0.00sec 0 0 Periodic 45.7 4275 8549 4979 16.5% 25.3%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 45.68 45.68 0.0000 1.6602 227423.93 227423.93 0.00 2999.05 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.2 83.53% 4274.88 3274 6150 4277.11 3982 4652 163103 163103 0.00
crit 7.5 16.47% 8549.33 6590 12300 8550.76 0 11105 64321 64321 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 468 2.7% 0.0 0.00sec 0 0 Periodic 27.1 4400 8804 5121 16.4% 15.4%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 27.09 27.09 0.0000 1.7088 138741.52 138741.52 0.00 2996.97 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.7 83.63% 4399.94 3295 6150 4414.18 3996 5043 99683 99683 0.00
crit 4.4 16.37% 8804.45 6590 12300 8734.80 0 11935 39058 39058 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 318 1.8% 0.0 0.00sec 0 0 Periodic 17.4 4625 9252 5389 16.5% 10.3%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 17.45 17.45 0.0000 1.7708 94028.47 94028.47 0.00 3043.49 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.6 83.49% 4625.25 3479 6150 4624.77 0 5391 67371 67371 0.00
crit 2.9 16.51% 9252.20 6959 12300 8782.70 0 11935 26658 26658 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 137 0.8% 0.0 0.00sec 0 0 Periodic 7.3 4768 9536 5554 16.5% 4.3%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 7.29 7.29 0.0000 1.7756 40474.64 40474.64 0.00 3127.87 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.1 83.52% 4767.81 3479 6103 3409.51 0 5468 29020 29020 0.00
crit 1.2 16.48% 9535.62 6959 12205 5616.56 0 12205 11455 11455 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Volatile Blood Explosion 325 1.9% 7.1 37.86sec 13853 0 Direct 7.0 12064 24126 14054 16.5%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.05 6.95 0.00 0.00 0.0000 0.0000 97680.58 97680.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.80 83.50% 12063.91 10240 12770 12055.74 0 12770 70016 70016 0.00
crit 1.15 16.50% 24126.27 20481 25540 16664.71 0 25540 27664 27664 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies. Deals increased damage when striking multiple targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
  • base_dd_mult:1.00
 
pet - darkglare 5710 / 772
Eye Beam (dark_glare) 5710 4.5% 31.7 6.63sec 7208 5913 Direct 31.7 6187 12374 7208 16.5%  

Stats details: dark_glare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.69 31.69 0.00 0.00 1.2191 0.0000 228395.18 228395.18 0.00 5912.53 5912.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.46 83.50% 6186.97 3894 7971 6187.28 5698 6783 163691 163691 0.00
crit 5.23 16.50% 12374.23 7788 16066 12324.69 0 15819 64704 64704 0.00
 
 

Action details: dark_glare

Static Values
  • id:205231
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205231
  • name:Eye Beam
  • school:shadow
  • tooltip:
  • description:Fires an eye beam that deals {$s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.256000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
 
pet - succubus 2297 / 2297
Lash of Pain 1083 6.4% 64.5 4.74sec 5033 6107 Direct 64.5 4323 8649 5033 16.4%  

Stats details: lash_of_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.51 64.51 0.00 0.00 0.8241 0.0000 324671.79 324671.79 0.00 6106.53 6106.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.94 83.60% 4323.11 3889 5698 4323.14 4217 4429 233171 233171 0.00
crit 10.58 16.40% 8649.49 7778 11396 8649.07 7867 10972 91501 91501 0.00
 
 

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:7814
  • name:Lash of Pain
  • school:shadow
  • tooltip:
  • description:Lashes the target, dealing {$s1=0} Shadow damage. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
 
melee 1213 7.1% 123.8 2.43sec 2938 1218 Direct 123.8 2523 5046 2938 16.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.82 123.82 0.00 0.00 2.4127 0.0000 363750.98 520025.71 30.05 1217.62 1217.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 103.46 83.55% 2522.75 2267 3321 2522.79 2480 2563 261000 373130 30.05
crit 20.36 16.45% 5046.15 4534 6643 5046.21 4753 5428 102751 146896 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Deathbolt
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deathbolt
  • harmful:false
  • if_expr:
 
Dark Soul: Misery (dark_soul) 2.4 167.02sec

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.44 0.00 0.00 0.00 1.1554 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dark_soul

Static Values
  • id:113860
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_darkglare.remains<10&dot.phantom_singularity.remains|target.time_to_die<20+gcd|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up
Spelldata
  • id:113860
  • name:Dark Soul: Misery
  • school:shadow
  • tooltip:Haste increased by {$s1=30}%.
  • description:Infuses your soul with the misery of fallen foes, increasing haste by {$s1=30}% for {$d=20 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deathbolt
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deathbolt
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Darkglare 2.0 185.27sec

Stats details: summon_darkglare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9002 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_darkglare

Static Values
  • id:205180
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.agony.ticking&dot.corruption.ticking&(buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up)
Spelldata
  • id:205180
  • name:Summon Darkglare
  • school:shadow
  • tooltip:Summons a Darkglare from the Twisting Nether that blasts its target for Shadow damage, dealing increased damage for every damage over time effect you have active on any target.
  • description:Summons a Darkglare from the Twisting Nether that extends the duration of your damage over time effects on all enemies by {$s2=8} sec. The Darkglare will serve you for {$d=20 seconds}, blasting its target for {$205231s1=0} Shadow damage, increased by {$s3=10}% for every damage over time effect you have active on any target.
 
Summon Succubus 1.0 0.00sec

Stats details: summon_succubus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_succubus

Static Values
  • id:712
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:712
  • name:Summon Succubus
  • school:shadow
  • tooltip:
  • description:Summons a Succubus under your command to seduce enemy Humanoids, preventing them from attacking.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
active_uas 23.2 15.0 12.8sec 0.0sec 76.94% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • active_uas_1:54.24%
  • active_uas_2:10.58%
  • active_uas_3:3.24%
  • active_uas_4:5.70%
  • active_uas_5:3.18%
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:42.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dark Soul: Misery (dark_soul) 2.4 0.0 167.0sec 167.0sec 15.55% 0.00% 0.0(0.0) 2.1

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dark_soul_1:15.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:113860
  • name:Dark Soul: Misery
  • tooltip:Haste increased by {$s1=30}%.
  • description:Infuses your soul with the misery of fallen foes, increasing haste by {$s1=30}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.6 0.2 73.9sec 65.5sec 8.71% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_crit_1:8.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 74.1sec 65.7sec 8.75% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_haste_1:8.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.6 0.2 73.5sec 65.3sec 8.78% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_mastery_1:8.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 73.2sec 65.1sec 8.79% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_versatility_1:8.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 92.1sec 92.1sec 23.64% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Buff details

  • stat:intellect
  • amount:16.00

Stack Uptimes

  • kindled_soul_5:1.15%
  • kindled_soul_10:1.16%
  • kindled_soul_15:1.16%
  • kindled_soul_20:1.16%
  • kindled_soul_25:1.17%
  • kindled_soul_30:1.17%
  • kindled_soul_35:1.17%
  • kindled_soul_40:1.17%
  • kindled_soul_45:1.18%
  • kindled_soul_50:1.18%
  • kindled_soul_55:1.18%
  • kindled_soul_60:1.19%
  • kindled_soul_65:1.19%
  • kindled_soul_70:1.19%
  • kindled_soul_75:1.19%
  • kindled_soul_80:1.20%
  • kindled_soul_85:1.20%
  • kindled_soul_90:1.20%
  • kindled_soul_95:1.21%
  • kindled_soul_100:1.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by $w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining ${$268998U1*{$268998s1=9}} Intellect, which decays over $D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Masterful Navigation 6.1 22.5 52.0sec 10.3sec 66.83% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_masterful_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:50.00

Stack Uptimes

  • masterful_navigation_1:17.49%
  • masterful_navigation_2:16.94%
  • masterful_navigation_3:16.46%
  • masterful_navigation_4:15.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268899
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Masterful Navigation (_final) 5.4 0.0 52.0sec 52.0sec 17.54% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_masterful_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:600.00

Stack Uptimes

  • masterful_navigation_final_1:17.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268898
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.7 68.0sec 38.7sec 42.68% 0.00% 2.7(36.3) 0.0

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.28%
  • overwhelming_power_2:1.31%
  • overwhelming_power_3:1.34%
  • overwhelming_power_4:1.37%
  • overwhelming_power_5:1.41%
  • overwhelming_power_6:1.44%
  • overwhelming_power_7:1.48%
  • overwhelming_power_8:1.52%
  • overwhelming_power_9:1.55%
  • overwhelming_power_10:1.59%
  • overwhelming_power_11:1.64%
  • overwhelming_power_12:1.68%
  • overwhelming_power_13:1.72%
  • overwhelming_power_14:1.76%
  • overwhelming_power_15:1.81%
  • overwhelming_power_16:1.86%
  • overwhelming_power_17:1.91%
  • overwhelming_power_18:1.96%
  • overwhelming_power_19:2.01%
  • overwhelming_power_20:2.06%
  • overwhelming_power_21:2.12%
  • overwhelming_power_22:2.18%
  • overwhelming_power_23:2.24%
  • overwhelming_power_24:2.29%
  • overwhelming_power_25:1.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Deathbolt
agony Mana 17.0 17025.7 1000.0 1000.0 25.9
corruption Mana 20.8 20798.7 1000.0 1000.0 24.1
deathbolt Mana 9.9 19898.9 2000.0 2000.0 16.7
haunt Mana 18.4 36844.5 2000.0 2114.8 4.3
shadow_bolt Mana 91.0 182075.4 2000.0 2000.0 3.9
summon_darkglare Mana 2.0 4000.0 2000.0 2000.0 0.0
unstable_affliction Soul Shard 38.1 38.1 1.0 1.0 28725.1
pet - succubus
lash_of_pain Energy 64.5 3870.9 60.0 60.0 83.9
Resource Gains Type Count Total Average Overflow
agony Soul Shard 35.37 35.37 (97.32%) 1.00 0.00 0.00%
mana_regen Mana 597.23 277714.14 (100.00%) 465.00 21766.84 7.27%
unstable_affliction_refund Soul Shard 0.97 0.97 (2.68%) 1.00 0.00 0.00%
pet - darkglare
energy_regen Energy 31.69 0.00 (0.00%) 0.00 529.47 100.00%
pet - succubus
energy_regen Energy 2654.43 3700.08 (100.00%) 1.39 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 925.71 935.47
Soul Shard 0.12 0.13
Combat End Resource Mean Min Max
Mana 97065.73 89661.00 100000.00
Soul Shard 1.20 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.0%

Statistics & Data Analysis

Fight Length
Sample Data T22_Warlock_Affliction Fight Length
Count 24999
Mean 300.00
Minimum 240.01
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Warlock_Affliction Damage Per Second
Count 24999
Mean 17043.02
Minimum 15727.54
Maximum 18894.01
Spread ( max - min ) 3166.47
Range [ ( max - min ) / 2 * 100% ] 9.29%
Standard Deviation 443.8704
5th Percentile 16377.29
95th Percentile 17834.02
( 95th Percentile - 5th Percentile ) 1456.73
Mean Distribution
Standard Deviation 2.8073
95.00% Confidence Intervall ( 17037.52 - 17048.53 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2606
0.1 Scale Factor Error with Delta=300 1682
0.05 Scale Factor Error with Delta=300 6728
0.01 Scale Factor Error with Delta=300 168189
Priority Target DPS
Sample Data T22_Warlock_Affliction Priority Target Damage Per Second
Count 24999
Mean 17043.02
Minimum 15727.54
Maximum 18894.01
Spread ( max - min ) 3166.47
Range [ ( max - min ) / 2 * 100% ] 9.29%
Standard Deviation 443.8704
5th Percentile 16377.29
95th Percentile 17834.02
( 95th Percentile - 5th Percentile ) 1456.73
Mean Distribution
Standard Deviation 2.8073
95.00% Confidence Intervall ( 17037.52 - 17048.53 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2606
0.1 Scale Factor Error with Delta=300 1682
0.05 Scale Factor Error with Delta=300 6728
0.01 Scale Factor Error with Delta=300 168189
DPS(e)
Sample Data T22_Warlock_Affliction Damage Per Second (Effective)
Count 24999
Mean 17043.02
Minimum 15727.54
Maximum 18894.01
Spread ( max - min ) 3166.47
Range [ ( max - min ) / 2 * 100% ] 9.29%
Damage
Sample Data T22_Warlock_Affliction Damage
Count 24999
Mean 4185505.75
Minimum 3245351.47
Maximum 5233950.61
Spread ( max - min ) 1988599.14
Range [ ( max - min ) / 2 * 100% ] 23.76%
DTPS
Sample Data T22_Warlock_Affliction Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Warlock_Affliction Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Warlock_Affliction Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Warlock_Affliction Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Warlock_Affliction Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Warlock_Affliction Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Warlock_AfflictionTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Warlock_Affliction Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 seed_of_corruption,if=spell_targets.seed_of_corruption_aoe>=3
8 0.00 haunt
9 0.00 shadow_bolt,if=!talent.haunt.enabled&spell_targets.seed_of_corruption_aoe<3
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=use_seed,value=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up|talent.siphon_life.enabled&spell_targets.seed_of_corruption>=5+raid_event.invulnerable.up|spell_targets.seed_of_corruption>=8+raid_event.invulnerable.up
0.00 variable,name=padding,op=set,value=action.shadow_bolt.execute_time*azerite.cascading_calamity.enabled
0.00 variable,name=padding,op=reset,value=gcd,if=azerite.cascading_calamity.enabled&(talent.drain_soul.enabled|talent.deathbolt.enabled&cooldown.deathbolt.remains<=gcd)
0.00 variable,name=maintain_se,value=spell_targets.seed_of_corruption_aoe<=1+talent.writhe_in_agony.enabled+talent.absolute_corruption.enabled*2+(talent.writhe_in_agony.enabled&talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>2)+(talent.siphon_life.enabled&!talent.creeping_death.enabled&!talent.drain_soul.enabled)+raid_event.invulnerable.up
A 0.00 call_action_list,name=cooldowns
0.00 drain_soul,interrupt_global=1,chain=1,cycle_targets=1,if=target.time_to_die<=gcd&soul_shard<5
B 17.49 haunt,if=spell_targets.seed_of_corruption_aoe<=2+raid_event.invulnerable.up
C 2.00 summon_darkglare,if=dot.agony.ticking&dot.corruption.ticking&(buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up)
D 9.95 deathbolt,if=cooldown.summon_darkglare.remains&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up
E 1.33 agony,target_if=min:dot.agony.remains,if=remains<=gcd+action.shadow_bolt.execute_time&target.time_to_die>8
F 0.08 unstable_affliction,target_if=!contagion&target.time_to_die<=8
0.00 drain_soul,target_if=min:debuff.shadow_embrace.remains,cancel_if=ticks_remain<5,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=gcd*2
0.00 shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=execute_time*2+travel_time&!action.shadow_bolt.in_flight
G 5.76 phantom_singularity,target_if=max:target.time_to_die,if=time>35&(cooldown.summon_darkglare.remains>=45|cooldown.summon_darkglare.remains<8)&target.time_to_die>16*spell_haste
0.00 vile_taint,target_if=max:target.time_to_die,if=time>15&target.time_to_die>=10
H 0.41 unstable_affliction,target_if=min:contagion,if=!variable.use_seed&soul_shard=5
0.00 seed_of_corruption,if=variable.use_seed&soul_shard=5
I 0.00 call_action_list,name=dots
J 1.00 phantom_singularity,if=time<=35
0.00 vile_taint,if=time<15
K 2.44 dark_soul,if=cooldown.summon_darkglare.remains<10&dot.phantom_singularity.remains|target.time_to_die<20+gcd|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up
0.00 berserking
L 0.00 call_action_list,name=spenders
M 0.00 call_action_list,name=fillers
actions.cooldowns
# count action,conditions
N 1.00 potion,if=(talent.dark_soul_misery.enabled&cooldown.summon_darkglare.up&cooldown.dark_soul.up)|cooldown.summon_darkglare.up|target.time_to_die<30
O 3.63 use_items,if=!cooldown.summon_darkglare.up,if=cooldown.summon_darkglare.remains>70|time_to_die<20|((buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains)&!cooldown.summon_darkglare.remains)
0.00 fireblood,if=!cooldown.summon_darkglare.up
0.00 blood_fury,if=!cooldown.summon_darkglare.up
actions.db_refresh
# count action,conditions
P 1.75 siphon_life,line_cd=15,if=(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.corruption.remains%dot.corruption.duration)&dot.siphon_life.remains<dot.siphon_life.duration*1.3
Q 3.94 agony,line_cd=15,if=(dot.agony.remains%dot.agony.duration)<=(dot.corruption.remains%dot.corruption.duration)&(dot.agony.remains%dot.agony.duration)<=(dot.siphon_life.remains%dot.siphon_life.duration)&dot.agony.remains<dot.agony.duration*1.3
R 2.67 corruption,line_cd=15,if=(dot.corruption.remains%dot.corruption.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.corruption.remains%dot.corruption.duration)<=(dot.siphon_life.remains%dot.siphon_life.duration)&dot.corruption.remains<dot.corruption.duration*1.3
actions.dots
# count action,conditions
0.00 seed_of_corruption,if=dot.corruption.remains<=action.seed_of_corruption.cast_time+time_to_shard+4.2*(1-talent.creeping_death.enabled*0.15)&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&!dot.seed_of_corruption.remains&!action.seed_of_corruption.in_flight
0.00 agony,target_if=min:remains,if=talent.creeping_death.enabled&active_dot.agony<6&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
S 11.76 agony,target_if=min:remains,if=!talent.creeping_death.enabled&active_dot.agony<8&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
T 17.50 siphon_life,target_if=min:remains,if=(active_dot.siphon_life<8-talent.creeping_death.enabled-spell_targets.sow_the_seeds_aoe)&target.time_to_die>10&refreshable&(!remains&spell_targets.seed_of_corruption_aoe=1|cooldown.summon_darkglare.remains>soul_shard*action.unstable_affliction.execute_time)
U 18.12 corruption,cycle_targets=1,if=spell_targets.seed_of_corruption_aoe<3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)&target.time_to_die>10
actions.fillers
# count action,conditions
V 4.07 unstable_affliction,line_cd=15,if=cooldown.deathbolt.remains<=gcd*2&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains>20
W 0.00 call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&(dot.agony.remains<dot.agony.duration*0.75|dot.corruption.remains<dot.corruption.duration*0.75|dot.siphon_life.remains<dot.siphon_life.duration*0.75)&cooldown.deathbolt.remains<=action.agony.gcd*4&cooldown.summon_darkglare.remains>20
X 0.00 call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains<=soul_shard*action.agony.gcd+action.agony.gcd*3&(dot.agony.remains<dot.agony.duration*1|dot.corruption.remains<dot.corruption.duration*1|dot.siphon_life.remains<dot.siphon_life.duration*1)
0.00 deathbolt,if=cooldown.summon_darkglare.remains>=30+gcd|cooldown.summon_darkglare.remains>140
0.00 shadow_bolt,if=buff.movement.up&buff.nightfall.remains
0.00 agony,if=buff.movement.up&!(talent.siphon_life.enabled&(prev_gcd.1.agony&prev_gcd.2.agony&prev_gcd.3.agony)|prev_gcd.1.agony)
0.00 siphon_life,if=buff.movement.up&!(prev_gcd.1.siphon_life&prev_gcd.2.siphon_life&prev_gcd.3.siphon_life)
0.00 corruption,if=buff.movement.up&!prev_gcd.1.corruption&!talent.absolute_corruption.enabled
0.00 drain_life,if=(buff.inevitable_demise.stack>=85-(spell_targets.seed_of_corruption_aoe-raid_event.invulnerable.up>2)*20&(cooldown.deathbolt.remains>execute_time|!talent.deathbolt.enabled)&(cooldown.phantom_singularity.remains>execute_time|!talent.phantom_singularity.enabled)&(cooldown.dark_soul.remains>execute_time|!talent.dark_soul_misery.enabled)&(cooldown.vile_taint.remains>execute_time|!talent.vile_taint.enabled)&cooldown.summon_darkglare.remains>execute_time+10|buff.inevitable_demise.stack>30&target.time_to_die<=10)
0.00 haunt
0.00 drain_soul,interrupt_global=1,chain=1,interrupt=1,cycle_targets=1,if=target.time_to_die<=gcd
0.00 drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains
0.00 drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se
0.00 drain_soul,interrupt_global=1,chain=1,interrupt=1
0.00 shadow_bolt,cycle_targets=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains&!action.shadow_bolt.in_flight
0.00 shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se
Y 91.75 shadow_bolt
actions.spenders
# count action,conditions
Z 8.45 unstable_affliction,if=cooldown.summon_darkglare.remains<=soul_shard*execute_time&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=soul_shard*execute_time)
a 0.00 call_action_list,name=fillers,if=(cooldown.summon_darkglare.remains<time_to_shard*(6-soul_shard)|cooldown.summon_darkglare.up)&time_to_die>cooldown.summon_darkglare.remains
0.00 seed_of_corruption,if=variable.use_seed
b 5.73 unstable_affliction,if=!variable.use_seed&!prev_gcd.1.summon_darkglare&(talent.deathbolt.enabled&cooldown.deathbolt.remains<=execute_time&!azerite.cascading_calamity.enabled|(soul_shard>=5&spell_targets.seed_of_corruption_aoe<2|soul_shard>=2&spell_targets.seed_of_corruption_aoe>=2)&target.time_to_die>4+execute_time&spell_targets.seed_of_corruption_aoe=1|target.time_to_die<=8+execute_time*soul_shard)
c 19.54 unstable_affliction,if=!variable.use_seed&contagion<=cast_time+variable.padding
0.00 unstable_affliction,cycle_targets=1,if=!variable.use_seed&(!talent.deathbolt.enabled|cooldown.deathbolt.remains>time_to_shard|soul_shard>1)&(!talent.vile_taint.enabled|soul_shard>1)&contagion<=cast_time+variable.padding&(!azerite.cascading_calamity.enabled|buff.cascading_calamity.remains>time_to_shard)

Sample Sequence

012368ETUJKZZZZOCDYYYYYBYYYYTSUYYcYYYYBYcUTQVYDYYYcYBGTUcSYYYYUcBTVQDYYYUcYTBYYcSYUYYGTOBbDYYSUcYTYYBcUYYSYTcRVDBYYYcTGSUYYcBYYYTUQcVDYYBYYTUYYSYYPBRQGKNZZZZZOCDYYYBYYYYTUYcYSYYBcYTUVQDYYYcBGTUYcYSYYYBTUcbDYYSYUYBTcYYYYUSGTcBORDYYcYYYYb

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Deathbolt 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Deathbolt 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation Deathbolt 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_succubus Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 8 haunt Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 default E agony Fluffy_Pillow 98000.0/100000: 98% mana | 3.0/5: 60% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.297 dots T siphon_life Fluffy_Pillow 98297.0/100000: 98% mana | 3.0/5: 60% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:02.295 dots U corruption Fluffy_Pillow 99295.0/100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:03.293 default J phantom_singularity Fluffy_Pillow 99293.0/100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:04.291 default K dark_soul Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:05.290 spenders Z unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, dark_soul, archive_of_the_titans(2), battle_potion_of_intellect
0:06.090 spenders Z unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, active_uas, dark_soul, archive_of_the_titans(2), battle_potion_of_intellect
0:06.890 spenders Z unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), dark_soul, masterful_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.690 spenders Z unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(3), dark_soul, masterful_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.491 cooldowns O use_items Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.491 default C summon_darkglare Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, archive_of_the_titans(2), battle_potion_of_intellect, kindled_soul(100)
0:09.291 default D deathbolt Fluffy_Pillow 98800.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, archive_of_the_titans(2), battle_potion_of_intellect, kindled_soul(100)
0:10.091 fillers Y shadow_bolt Fluffy_Pillow 97600.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(95)
0:11.156 fillers Y shadow_bolt Fluffy_Pillow 96665.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(90)
0:12.221 fillers Y shadow_bolt Fluffy_Pillow 95730.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(85)
0:13.250 fillers Y shadow_bolt Fluffy_Pillow 94759.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(80)
0:14.279 fillers Y shadow_bolt Fluffy_Pillow 93788.0/100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(75)
0:15.309 default B haunt Fluffy_Pillow 92818.0/100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(70)
0:16.082 fillers Y shadow_bolt Fluffy_Pillow 91591.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(65)
0:17.111 fillers Y shadow_bolt Fluffy_Pillow 90620.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(60)
0:18.139 fillers Y shadow_bolt Fluffy_Pillow 89648.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(55)
0:19.171 fillers Y shadow_bolt Fluffy_Pillow 88680.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(50)
0:20.199 dots T siphon_life Fluffy_Pillow 87708.0/100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(45)
0:20.973 dots S agony Fluffy_Pillow 88482.0/100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(40)
0:21.748 dots U corruption Fluffy_Pillow 88257.0/100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(35)
0:22.522 fillers Y shadow_bolt Fluffy_Pillow 88031.0/100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(3), dark_soul, masterful_navigation, archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(30)
0:23.585 fillers Y shadow_bolt Fluffy_Pillow 87094.0/100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), dark_soul, masterful_navigation, archive_of_the_titans(5), kindled_soul(25)
0:24.649 spenders c unstable_affliction Fluffy_Pillow 86158.0/100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, masterful_navigation, archive_of_the_titans(5), kindled_soul(20)
0:25.649 fillers Y shadow_bolt Fluffy_Pillow 87158.0/100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation, archive_of_the_titans(6), kindled_soul(15)
0:26.979 fillers Y shadow_bolt Fluffy_Pillow 86488.0/100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(2), archive_of_the_titans(6), kindled_soul(10)
0:28.308 fillers Y shadow_bolt Fluffy_Pillow 85817.0/100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation(2), archive_of_the_titans(6), kindled_soul(5)
0:29.636 fillers Y shadow_bolt Fluffy_Pillow 85145.0/100000: 85% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation(2), archive_of_the_titans(6)
0:30.966 default B haunt Fluffy_Pillow 84475.0/100000: 84% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation(2), elemental_whirl_crit, archive_of_the_titans(7)
0:32.076 fillers Y shadow_bolt Fluffy_Pillow 83585.0/100000: 84% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation(2), elemental_whirl_crit, archive_of_the_titans(7)
0:33.406 spenders c unstable_affliction Fluffy_Pillow 82915.0/100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation(2), elemental_whirl_crit, archive_of_the_titans(7)
0:34.405 dots U corruption Fluffy_Pillow 83914.0/100000: 84% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(2), elemental_whirl_crit, archive_of_the_titans(7)
0:35.403 dots T siphon_life Fluffy_Pillow 83912.0/100000: 84% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(2), elemental_whirl_crit, archive_of_the_titans(8)
0:36.403 db_refresh Q agony Fluffy_Pillow 84912.0/100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(2), elemental_whirl_crit, archive_of_the_titans(8)
0:37.401 fillers V unstable_affliction Fluffy_Pillow 84910.0/100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(2), elemental_whirl_crit, archive_of_the_titans(8)
0:38.399 fillers Y shadow_bolt Fluffy_Pillow 85908.0/100000: 86% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(2), masterful_navigation(2), elemental_whirl_crit, archive_of_the_titans(8)
0:39.730 default D deathbolt Fluffy_Pillow 85239.0/100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(2), masterful_navigation(3), elemental_whirl_crit, archive_of_the_titans(8)
0:40.728 fillers Y shadow_bolt Fluffy_Pillow 84237.0/100000: 84% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), masterful_navigation(3), archive_of_the_titans(9)
0:42.058 fillers Y shadow_bolt Fluffy_Pillow 83567.0/100000: 84% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation(3), archive_of_the_titans(9)
0:43.786 fillers Y shadow_bolt Fluffy_Pillow 83295.0/100000: 83% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(9)
0:45.515 spenders c unstable_affliction Fluffy_Pillow 83024.0/100000: 83% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(10)
0:46.812 fillers Y shadow_bolt Fluffy_Pillow 84321.0/100000: 84% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(10)
0:48.540 default B haunt Fluffy_Pillow 84049.0/100000: 84% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(10)
0:49.837 default G phantom_singularity Fluffy_Pillow 83346.0/100000: 83% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(10)
0:51.133 dots T siphon_life Fluffy_Pillow 84642.0/100000: 85% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(11)
0:52.429 dots U corruption Fluffy_Pillow 85938.0/100000: 86% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(11)
0:53.727 spenders c unstable_affliction Fluffy_Pillow 86236.0/100000: 86% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(11)
0:55.023 dots S agony Fluffy_Pillow 87532.0/100000: 88% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(12)
0:56.320 fillers Y shadow_bolt Fluffy_Pillow 87829.0/100000: 88% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(12)
0:58.048 fillers Y shadow_bolt Fluffy_Pillow 87557.0/100000: 88% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(12)
0:59.776 fillers Y shadow_bolt Fluffy_Pillow 87285.0/100000: 87% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(12)
1:01.504 fillers Y shadow_bolt Fluffy_Pillow 87013.0/100000: 87% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(13)
1:03.231 dots U corruption Fluffy_Pillow 86740.0/100000: 87% mana | 1.0/5: 20% soul_shard overwhelming_power(24), archive_of_the_titans(13)
1:04.437 spenders c unstable_affliction Fluffy_Pillow 86946.0/100000: 87% mana | 2.0/5: 40% soul_shard overwhelming_power(23), archive_of_the_titans(13)
1:05.642 default B haunt Fluffy_Pillow 88151.0/100000: 88% mana | 1.0/5: 20% soul_shard active_uas, overwhelming_power(22), archive_of_the_titans(14)
1:06.855 dots T siphon_life Fluffy_Pillow 87364.0/100000: 87% mana | 1.0/5: 20% soul_shard active_uas, overwhelming_power(21), archive_of_the_titans(14)
1:08.069 fillers V unstable_affliction Fluffy_Pillow 88578.0/100000: 89% mana | 1.0/5: 20% soul_shard active_uas, overwhelming_power(19), archive_of_the_titans(14)
1:09.293 db_refresh Q agony Fluffy_Pillow 89802.0/100000: 90% mana | 0.0/5: 0% soul_shard active_uas(2), overwhelming_power(18), archive_of_the_titans(14)
1:10.520 default D deathbolt Fluffy_Pillow 90029.0/100000: 90% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation, overwhelming_power(17), archive_of_the_titans(15)
1:11.749 fillers Y shadow_bolt Fluffy_Pillow 89258.0/100000: 89% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation, overwhelming_power(16), archive_of_the_titans(15)
1:13.393 fillers Y shadow_bolt Fluffy_Pillow 88902.0/100000: 89% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation, overwhelming_power(14), archive_of_the_titans(15)
1:15.045 fillers Y shadow_bolt Fluffy_Pillow 88554.0/100000: 89% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, overwhelming_power(12), archive_of_the_titans(16)
1:16.709 dots U corruption Fluffy_Pillow 88218.0/100000: 88% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, overwhelming_power(11), archive_of_the_titans(16)
1:17.961 spenders c unstable_affliction Fluffy_Pillow 88470.0/100000: 88% mana | 1.0/5: 20% soul_shard masterful_navigation, overwhelming_power(10), archive_of_the_titans(16)
1:19.217 fillers Y shadow_bolt Fluffy_Pillow 89726.0/100000: 90% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, overwhelming_power(8), archive_of_the_titans(16)
1:20.902 dots T siphon_life Fluffy_Pillow 89411.0/100000: 89% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), overwhelming_power(7), archive_of_the_titans(17)
1:22.172 default B haunt Fluffy_Pillow 90681.0/100000: 91% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(5), archive_of_the_titans(17)
1:23.448 fillers Y shadow_bolt Fluffy_Pillow 89957.0/100000: 90% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(4), archive_of_the_titans(17)
1:25.153 fillers Y shadow_bolt Fluffy_Pillow 89662.0/100000: 90% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(2), archive_of_the_titans(18)
1:26.870 spenders c unstable_affliction Fluffy_Pillow 89379.0/100000: 89% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power, archive_of_the_titans(18)
1:28.161 dots S agony Fluffy_Pillow 90670.0/100000: 91% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(18)
1:29.458 fillers Y shadow_bolt Fluffy_Pillow 90967.0/100000: 91% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(18)
1:31.186 dots U corruption Fluffy_Pillow 90695.0/100000: 91% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(19)
1:32.482 fillers Y shadow_bolt Fluffy_Pillow 90991.0/100000: 91% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(19)
1:34.209 fillers Y shadow_bolt Fluffy_Pillow 90718.0/100000: 91% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(19)
1:35.939 default G phantom_singularity Fluffy_Pillow 90448.0/100000: 90% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
1:37.236 dots T siphon_life Fluffy_Pillow 91745.0/100000: 92% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
1:38.534 cooldowns O use_items Fluffy_Pillow 93043.0/100000: 93% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
1:38.534 default B haunt Fluffy_Pillow 93043.0/100000: 93% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20), kindled_soul(100)
1:39.831 spenders b unstable_affliction Fluffy_Pillow 92340.0/100000: 92% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20), kindled_soul(95)
1:41.128 default D deathbolt Fluffy_Pillow 93637.0/100000: 94% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20), kindled_soul(90)
1:42.424 fillers Y shadow_bolt Fluffy_Pillow 92933.0/100000: 93% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20), kindled_soul(85)
1:44.150 fillers Y shadow_bolt Fluffy_Pillow 92659.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), kindled_soul(75)
1:45.878 dots S agony Fluffy_Pillow 92387.0/100000: 92% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), kindled_soul(65)
1:47.176 dots U corruption Fluffy_Pillow 92685.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), kindled_soul(60)
1:48.472 spenders c unstable_affliction Fluffy_Pillow 92981.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), kindled_soul(55)
1:49.768 fillers Y shadow_bolt Fluffy_Pillow 94277.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), kindled_soul(45)
1:51.498 dots T siphon_life Fluffy_Pillow 94007.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), kindled_soul(40)
1:52.793 fillers Y shadow_bolt Fluffy_Pillow 95302.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20), kindled_soul(30)
1:54.520 fillers Y shadow_bolt Fluffy_Pillow 95029.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20), kindled_soul(25)
1:56.248 default B haunt Fluffy_Pillow 94757.0/100000: 95% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20), kindled_soul(15)
1:57.545 spenders c unstable_affliction Fluffy_Pillow 94054.0/100000: 94% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20), kindled_soul(5)
1:58.841 dots U corruption Fluffy_Pillow 95350.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
2:00.137 fillers Y shadow_bolt Fluffy_Pillow 95646.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
2:01.740 fillers Y shadow_bolt Fluffy_Pillow 95249.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
2:03.349 dots S agony Fluffy_Pillow 94858.0/100000: 95% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
2:04.564 fillers Y shadow_bolt Fluffy_Pillow 95073.0/100000: 95% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
2:06.189 dots T siphon_life Fluffy_Pillow 94698.0/100000: 95% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
2:07.416 spenders c unstable_affliction Fluffy_Pillow 95925.0/100000: 96% mana | 2.0/5: 40% soul_shard masterful_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
2:08.645 db_refresh R corruption Fluffy_Pillow 97154.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, overwhelming_power(16), archive_of_the_titans(20)
2:09.877 fillers V unstable_affliction Fluffy_Pillow 97386.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, overwhelming_power(15), archive_of_the_titans(20)
2:11.114 default D deathbolt Fluffy_Pillow 98623.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation, overwhelming_power(13), archive_of_the_titans(20)
2:12.372 default B haunt Fluffy_Pillow 97881.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation, overwhelming_power(12), archive_of_the_titans(20)
2:13.787 fillers Y shadow_bolt Fluffy_Pillow 97296.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation, overwhelming_power(11), archive_of_the_titans(20)
2:15.456 fillers Y shadow_bolt Fluffy_Pillow 96965.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation, overwhelming_power(9), archive_of_the_titans(20)
2:17.135 fillers Y shadow_bolt Fluffy_Pillow 96644.0/100000: 97% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation, overwhelming_power(7), archive_of_the_titans(20)
2:18.826 spenders c unstable_affliction Fluffy_Pillow 96335.0/100000: 96% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation, overwhelming_power(6), archive_of_the_titans(20)
2:20.099 dots T siphon_life Fluffy_Pillow 97608.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, overwhelming_power(4), archive_of_the_titans(20)
2:21.380 default G phantom_singularity Fluffy_Pillow 98889.0/100000: 99% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation, overwhelming_power(3), archive_of_the_titans(20)
2:22.663 dots S agony Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation, overwhelming_power(24), archive_of_the_titans(20)
2:23.866 dots U corruption Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation, overwhelming_power(23), archive_of_the_titans(20)
2:25.075 fillers Y shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation, overwhelming_power(21), archive_of_the_titans(20)
2:26.692 fillers Y shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), overwhelming_power(24), archive_of_the_titans(20)
2:28.295 spenders c unstable_affliction Fluffy_Pillow 97606.0/100000: 98% mana | 2.0/5: 40% soul_shard masterful_navigation(2), overwhelming_power(22), archive_of_the_titans(20)
2:29.509 default B haunt Fluffy_Pillow 98820.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
2:30.725 fillers Y shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
2:32.347 fillers Y shadow_bolt Fluffy_Pillow 97627.0/100000: 98% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), elemental_whirl_haste, overwhelming_power(18), archive_of_the_titans(20)
2:33.930 fillers Y shadow_bolt Fluffy_Pillow 97210.0/100000: 97% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), elemental_whirl_haste, overwhelming_power(17), archive_of_the_titans(20)
2:35.516 dots T siphon_life Fluffy_Pillow 96796.0/100000: 97% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(3), elemental_whirl_haste, overwhelming_power(15), archive_of_the_titans(20)
2:36.714 dots U corruption Fluffy_Pillow 97994.0/100000: 98% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(3), elemental_whirl_haste, overwhelming_power(14), archive_of_the_titans(20)
2:37.918 db_refresh Q agony Fluffy_Pillow 98198.0/100000: 98% mana | 2.0/5: 40% soul_shard masterful_navigation(3), elemental_whirl_haste, overwhelming_power(13), archive_of_the_titans(20)
2:39.124 spenders c unstable_affliction Fluffy_Pillow 98404.0/100000: 98% mana | 3.0/5: 60% soul_shard masterful_navigation(3), elemental_whirl_haste, overwhelming_power(11), archive_of_the_titans(20)
2:40.337 fillers V unstable_affliction Fluffy_Pillow 99617.0/100000: 100% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(3), elemental_whirl_haste, overwhelming_power(10), archive_of_the_titans(20)
2:41.554 default D deathbolt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation(3), elemental_whirl_haste, overwhelming_power(9), archive_of_the_titans(20)
2:42.776 fillers Y shadow_bolt Fluffy_Pillow 99222.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation(3), overwhelming_power(8), archive_of_the_titans(20)
2:44.461 fillers Y shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard active_uas(2), masterful_navigation(3), overwhelming_power(6), archive_of_the_titans(20)
2:46.158 default B haunt Fluffy_Pillow 97702.0/100000: 98% mana | 2.0/5: 40% soul_shard active_uas(2), masterful_navigation(3), overwhelming_power(4), archive_of_the_titans(20)
2:47.439 fillers Y shadow_bolt Fluffy_Pillow 96983.0/100000: 97% mana | 2.0/5: 40% soul_shard active_uas(2), masterful_navigation(3), overwhelming_power(3), archive_of_the_titans(20)
2:49.150 fillers Y shadow_bolt Fluffy_Pillow 96694.0/100000: 97% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(3), overwhelming_power, archive_of_the_titans(20)
2:50.872 dots T siphon_life Fluffy_Pillow 96416.0/100000: 96% mana | 3.0/5: 60% soul_shard masterful_navigation(3), archive_of_the_titans(20)
2:52.167 dots U corruption Fluffy_Pillow 97711.0/100000: 98% mana | 3.0/5: 60% soul_shard masterful_navigation(3), archive_of_the_titans(20)
2:53.465 fillers Y shadow_bolt Fluffy_Pillow 98009.0/100000: 98% mana | 3.0/5: 60% soul_shard masterful_navigation(3), elemental_whirl_haste, archive_of_the_titans(20)
2:55.137 fillers Y shadow_bolt Fluffy_Pillow 97681.0/100000: 98% mana | 3.0/5: 60% soul_shard masterful_navigation(4), elemental_whirl_haste, archive_of_the_titans(20)
2:56.808 dots S agony Fluffy_Pillow 97352.0/100000: 97% mana | 3.0/5: 60% soul_shard masterful_navigation(4), elemental_whirl_haste, archive_of_the_titans(20)
2:58.061 fillers Y shadow_bolt Fluffy_Pillow 97605.0/100000: 98% mana | 3.0/5: 60% soul_shard masterful_navigation(4), elemental_whirl_haste, archive_of_the_titans(20)
2:59.733 fillers Y shadow_bolt Fluffy_Pillow 97277.0/100000: 97% mana | 3.0/5: 60% soul_shard masterful_navigation(4), elemental_whirl_haste, archive_of_the_titans(20)
3:01.404 db_refresh P siphon_life Fluffy_Pillow 96948.0/100000: 97% mana | 4.0/5: 80% soul_shard masterful_navigation(4), elemental_whirl_haste, overwhelming_power(25), archive_of_the_titans(20)
3:02.569 default B haunt Fluffy_Pillow 98113.0/100000: 98% mana | 4.0/5: 80% soul_shard masterful_navigation(4), elemental_whirl_haste, overwhelming_power(24), archive_of_the_titans(20)
3:03.736 db_refresh R corruption Fluffy_Pillow 97280.0/100000: 97% mana | 4.0/5: 80% soul_shard masterful_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
3:04.938 db_refresh Q agony Fluffy_Pillow 97482.0/100000: 97% mana | 4.0/5: 80% soul_shard masterful_navigation(4), overwhelming_power(24), archive_of_the_titans(20)
3:06.141 default G phantom_singularity Fluffy_Pillow 97685.0/100000: 98% mana | 4.0/5: 80% soul_shard masterful_navigation(4), overwhelming_power(22), archive_of_the_titans(20)
3:07.592 default K dark_soul Fluffy_Pillow 99136.0/100000: 99% mana | 4.0/5: 80% soul_shard masterful_navigation(4), overwhelming_power(21), archive_of_the_titans(20)
3:08.809 cooldowns N potion Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard dark_soul, masterful_navigation(4), overwhelming_power(20), archive_of_the_titans(20)
3:08.809 spenders Z unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard dark_soul, masterful_navigation(4), overwhelming_power(20), archive_of_the_titans(20), battle_potion_of_intellect
3:09.783 spenders Z unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard active_uas, dark_soul, masterful_navigation(4), overwhelming_power(19), archive_of_the_titans(20), battle_potion_of_intellect
3:10.760 spenders Z unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard active_uas(2), dark_soul, masterful_navigation(4), elemental_whirl_crit, elemental_whirl_haste, overwhelming_power(18), archive_of_the_titans(20), battle_potion_of_intellect
3:11.713 spenders Z unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard active_uas(3), dark_soul, masterful_navigation_final, elemental_whirl_crit, elemental_whirl_haste, overwhelming_power(17), archive_of_the_titans(20), battle_potion_of_intellect
3:12.668 spenders Z unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard active_uas(4), dark_soul, masterful_navigation_final, elemental_whirl_crit, elemental_whirl_haste, overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
3:13.624 cooldowns O use_items Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation_final, elemental_whirl_crit, elemental_whirl_haste, overwhelming_power(15), archive_of_the_titans(20), battle_potion_of_intellect
3:13.624 default C summon_darkglare Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation_final, elemental_whirl_crit, elemental_whirl_haste, overwhelming_power(15), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(100)
3:14.584 default D deathbolt Fluffy_Pillow 98960.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation_final, elemental_whirl_crit, elemental_whirl_haste, overwhelming_power(14), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(100)
3:15.548 fillers Y shadow_bolt Fluffy_Pillow 97924.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation_final, elemental_whirl_crit, elemental_whirl_haste, overwhelming_power(13), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(95)
3:16.835 fillers Y shadow_bolt Fluffy_Pillow 97211.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation_final, elemental_whirl_crit, elemental_whirl_haste, overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(85)
3:18.123 fillers Y shadow_bolt Fluffy_Pillow 96499.0/100000: 96% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation_final, elemental_whirl_crit, elemental_whirl_haste, overwhelming_power(10), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(80)
3:19.421 default B haunt Fluffy_Pillow 95797.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas(5), dark_soul, masterful_navigation_final, elemental_whirl_crit, elemental_whirl_haste, overwhelming_power(9), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(75)
3:20.400 fillers Y shadow_bolt Fluffy_Pillow 94776.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas(5), dark_soul, masterful_navigation_final, elemental_whirl_haste, overwhelming_power(8), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(70)
3:21.704 fillers Y shadow_bolt Fluffy_Pillow 94080.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas(5), dark_soul, masterful_navigation, overwhelming_power(7), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(60)
3:23.056 fillers Y shadow_bolt Fluffy_Pillow 93432.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas(5), dark_soul, masterful_navigation, overwhelming_power(24), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(55)
3:24.341 fillers Y shadow_bolt Fluffy_Pillow 92717.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas(5), dark_soul, masterful_navigation, overwhelming_power(23), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(50)
3:25.629 dots T siphon_life Fluffy_Pillow 92005.0/100000: 92% mana | 1.0/5: 20% soul_shard active_uas(5), dark_soul, masterful_navigation, elemental_whirl_haste, overwhelming_power(22), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(40)
3:26.568 dots U corruption Fluffy_Pillow 92944.0/100000: 93% mana | 2.0/5: 40% soul_shard active_uas(4), dark_soul, masterful_navigation, elemental_whirl_haste, overwhelming_power(21), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(40)
3:27.513 fillers Y shadow_bolt Fluffy_Pillow 92889.0/100000: 93% mana | 2.0/5: 40% soul_shard active_uas(3), dark_soul, masterful_navigation, elemental_whirl_haste, overwhelming_power(20), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(35)
3:28.773 spenders c unstable_affliction Fluffy_Pillow 92149.0/100000: 92% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation, elemental_whirl_haste, overwhelming_power(19), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(25)
3:29.957 fillers Y shadow_bolt Fluffy_Pillow 93333.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_haste, overwhelming_power(24), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(20)
3:31.514 dots S agony Fluffy_Pillow 92890.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_versatility, elemental_whirl_haste, overwhelming_power(22), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(15)
3:32.690 fillers Y shadow_bolt Fluffy_Pillow 93066.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_versatility, elemental_whirl_haste, overwhelming_power(21), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(5)
3:34.258 fillers Y shadow_bolt Fluffy_Pillow 92634.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_versatility, elemental_whirl_haste, overwhelming_power(24), archive_of_the_titans(20)
3:35.812 default B haunt Fluffy_Pillow 92188.0/100000: 92% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), elemental_whirl_versatility, overwhelming_power(23), archive_of_the_titans(20)
3:37.019 spenders c unstable_affliction Fluffy_Pillow 91395.0/100000: 91% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), elemental_whirl_versatility, overwhelming_power(21), archive_of_the_titans(20)
3:38.236 fillers Y shadow_bolt Fluffy_Pillow 92612.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), elemental_whirl_versatility, overwhelming_power(20), archive_of_the_titans(20)
3:39.859 dots T siphon_life Fluffy_Pillow 92235.0/100000: 92% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), elemental_whirl_versatility, overwhelming_power(19), archive_of_the_titans(20)
3:41.080 dots U corruption Fluffy_Pillow 93456.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
3:42.310 fillers V unstable_affliction Fluffy_Pillow 93686.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(16), archive_of_the_titans(20)
3:43.541 db_refresh Q agony Fluffy_Pillow 94917.0/100000: 95% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(15), archive_of_the_titans(20)
3:44.779 default D deathbolt Fluffy_Pillow 95155.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(14), archive_of_the_titans(20)
3:46.020 fillers Y shadow_bolt Fluffy_Pillow 94396.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(12), archive_of_the_titans(20)
3:47.683 fillers Y shadow_bolt Fluffy_Pillow 94059.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(11), archive_of_the_titans(20)
3:49.351 fillers Y shadow_bolt Fluffy_Pillow 93727.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(9), archive_of_the_titans(20)
3:51.032 spenders c unstable_affliction Fluffy_Pillow 93408.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(7), archive_of_the_titans(20)
3:52.300 default B haunt Fluffy_Pillow 94676.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(6), archive_of_the_titans(20)
3:53.573 default G phantom_singularity Fluffy_Pillow 93949.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(5), archive_of_the_titans(20)
3:54.850 dots T siphon_life Fluffy_Pillow 95226.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(4), archive_of_the_titans(20)
3:56.131 dots U corruption Fluffy_Pillow 96507.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(2), archive_of_the_titans(20)
3:57.419 fillers Y shadow_bolt Fluffy_Pillow 96795.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power, archive_of_the_titans(20)
3:59.141 spenders c unstable_affliction Fluffy_Pillow 96517.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20)
4:00.436 fillers Y shadow_bolt Fluffy_Pillow 97812.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
4:02.162 dots S agony Fluffy_Pillow 97538.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
4:03.458 fillers Y shadow_bolt Fluffy_Pillow 97834.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
4:05.187 fillers Y shadow_bolt Fluffy_Pillow 97563.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
4:06.915 fillers Y shadow_bolt Fluffy_Pillow 97291.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
4:08.642 default B haunt Fluffy_Pillow 97018.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
4:09.940 dots T siphon_life Fluffy_Pillow 96316.0/100000: 96% mana | 1.0/5: 20% soul_shard masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
4:11.237 dots U corruption Fluffy_Pillow 97613.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
4:12.533 spenders c unstable_affliction Fluffy_Pillow 97909.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
4:13.828 spenders b unstable_affliction Fluffy_Pillow 99204.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
4:15.123 default D deathbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(3), archive_of_the_titans(20)
4:16.420 fillers Y shadow_bolt Fluffy_Pillow 99297.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(3), archive_of_the_titans(20)
4:18.148 fillers Y shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20)
4:19.877 dots S agony Fluffy_Pillow 97734.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20)
4:21.173 fillers Y shadow_bolt Fluffy_Pillow 98030.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20)
4:22.901 dots U corruption Fluffy_Pillow 97758.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20)
4:24.198 fillers Y shadow_bolt Fluffy_Pillow 98055.0/100000: 98% mana | 0.0/5: 0% soul_shard masterful_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20)
4:25.927 default B haunt Fluffy_Pillow 97784.0/100000: 98% mana | 0.0/5: 0% soul_shard masterful_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20)
4:27.223 dots T siphon_life Fluffy_Pillow 97080.0/100000: 97% mana | 0.0/5: 0% soul_shard masterful_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20)
4:28.518 spenders c unstable_affliction Fluffy_Pillow 98375.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation_final, archive_of_the_titans(20)
4:29.815 fillers Y shadow_bolt Fluffy_Pillow 99672.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, archive_of_the_titans(20)
4:31.543 fillers Y shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, archive_of_the_titans(20)
4:33.273 fillers Y shadow_bolt Fluffy_Pillow 97735.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, archive_of_the_titans(20)
4:35.003 fillers Y shadow_bolt Fluffy_Pillow 97465.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, archive_of_the_titans(20)
4:36.729 dots U corruption Fluffy_Pillow 97191.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(20)
4:38.027 dots S agony Fluffy_Pillow 97489.0/100000: 97% mana | 1.0/5: 20% soul_shard archive_of_the_titans(20)
4:39.323 default G phantom_singularity Fluffy_Pillow 97785.0/100000: 98% mana | 1.0/5: 20% soul_shard archive_of_the_titans(20)
4:40.621 dots T siphon_life Fluffy_Pillow 99083.0/100000: 99% mana | 1.0/5: 20% soul_shard archive_of_the_titans(20)
4:41.917 spenders c unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard masterful_navigation, archive_of_the_titans(20)
4:43.214 default B haunt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, archive_of_the_titans(20)
4:44.510 cooldowns O use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, archive_of_the_titans(20)
4:44.510 db_refresh R corruption Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, archive_of_the_titans(20), kindled_soul(100)
4:45.806 default D deathbolt Fluffy_Pillow 98300.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20), kindled_soul(95)
4:47.100 fillers Y shadow_bolt Fluffy_Pillow 97594.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20), kindled_soul(90)
4:48.829 fillers Y shadow_bolt Fluffy_Pillow 97323.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), elemental_whirl_mastery, archive_of_the_titans(20), kindled_soul(80)
4:50.555 spenders c unstable_affliction Fluffy_Pillow 97049.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), elemental_whirl_mastery, archive_of_the_titans(20), kindled_soul(70)
4:51.851 fillers Y shadow_bolt Fluffy_Pillow 98345.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), elemental_whirl_mastery, archive_of_the_titans(20), kindled_soul(65)
4:53.579 fillers Y shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), kindled_soul(55)
4:55.305 fillers Y shadow_bolt Fluffy_Pillow 97731.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), kindled_soul(50)
4:57.033 fillers Y shadow_bolt Fluffy_Pillow 97459.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), kindled_soul(40)
4:58.760 spenders b unstable_affliction Fluffy_Pillow 97186.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20), kindled_soul(30)

Stats

Level Bonus (120) Race Bonus (goblin) Raid-Buffed Unbuffed Gear Amount
Strength 1467 -3 1524 1464 0
Agility 1467 1 1528 1468 0
Stamina 1001 -1 9025 8205 7205
Intellect 1467 3 8169 7008 5205 (377)
Spirit 0 0 0 0 0
Health 180500 164100 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8169 7008 0
Crit 16.14% 16.14% 802
Haste 16.06% 16.06% 1014
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 62.35% 62.35% 1220
Armor 1165 1165 1165
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Visage of the Ascended Prophet
ilevel: 390, stats: { 155 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Mantle of Contained Corruption
ilevel: 390, stats: { 143 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 190 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 161 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 115 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Ring of the Infinite Void
ilevel: 385, stats: { +312 Sta, +240 Mastery, +191 Crit }, enchant: { +37 Mastery }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Mastery }
Local Trinket1 Balefire Branch
ilevel: 370, stats: { +164 Mastery }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 92 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: masterful_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Nightfall (Affliction Warlock) Drain Soul (Affliction Warlock) Deathbolt (Affliction Warlock)
30 Writhe in Agony (Affliction Warlock) Absolute Corruption (Affliction Warlock) Siphon Life (Affliction Warlock)
45 Demon Skin Burning Rush Dark Pact
60 Sow the Seeds (Affliction Warlock) Phantom Singularity Vile Taint (Affliction Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Shadow Embrace (Affliction Warlock) Haunt (Affliction Warlock) Grimoire of Sacrifice
100 Soul Conduit Creeping Death (Affliction Warlock) Dark Soul: Misery (Affliction Warlock)

Profile

warlock="Deathbolt"
source=default
spec=affliction
level=120
race=goblin
role=spell
position=ranged_back
talents=3302023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/seed_of_corruption,if=spell_targets.seed_of_corruption_aoe>=3
actions.precombat+=/haunt
actions.precombat+=/shadow_bolt,if=!talent.haunt.enabled&spell_targets.seed_of_corruption_aoe<3

# Executed every time the actor is available.
actions=variable,name=use_seed,value=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up|talent.siphon_life.enabled&spell_targets.seed_of_corruption>=5+raid_event.invulnerable.up|spell_targets.seed_of_corruption>=8+raid_event.invulnerable.up
actions+=/variable,name=padding,op=set,value=action.shadow_bolt.execute_time*azerite.cascading_calamity.enabled
actions+=/variable,name=padding,op=reset,value=gcd,if=azerite.cascading_calamity.enabled&(talent.drain_soul.enabled|talent.deathbolt.enabled&cooldown.deathbolt.remains<=gcd)
actions+=/variable,name=maintain_se,value=spell_targets.seed_of_corruption_aoe<=1+talent.writhe_in_agony.enabled+talent.absolute_corruption.enabled*2+(talent.writhe_in_agony.enabled&talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>2)+(talent.siphon_life.enabled&!talent.creeping_death.enabled&!talent.drain_soul.enabled)+raid_event.invulnerable.up
actions+=/call_action_list,name=cooldowns
actions+=/drain_soul,interrupt_global=1,chain=1,cycle_targets=1,if=target.time_to_die<=gcd&soul_shard<5
actions+=/haunt,if=spell_targets.seed_of_corruption_aoe<=2+raid_event.invulnerable.up
actions+=/summon_darkglare,if=dot.agony.ticking&dot.corruption.ticking&(buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up)
actions+=/deathbolt,if=cooldown.summon_darkglare.remains&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up
actions+=/agony,target_if=min:dot.agony.remains,if=remains<=gcd+action.shadow_bolt.execute_time&target.time_to_die>8
actions+=/unstable_affliction,target_if=!contagion&target.time_to_die<=8
actions+=/drain_soul,target_if=min:debuff.shadow_embrace.remains,cancel_if=ticks_remain<5,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=gcd*2
actions+=/shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=execute_time*2+travel_time&!action.shadow_bolt.in_flight
actions+=/phantom_singularity,target_if=max:target.time_to_die,if=time>35&(cooldown.summon_darkglare.remains>=45|cooldown.summon_darkglare.remains<8)&target.time_to_die>16*spell_haste
actions+=/vile_taint,target_if=max:target.time_to_die,if=time>15&target.time_to_die>=10
actions+=/unstable_affliction,target_if=min:contagion,if=!variable.use_seed&soul_shard=5
actions+=/seed_of_corruption,if=variable.use_seed&soul_shard=5
actions+=/call_action_list,name=dots
actions+=/phantom_singularity,if=time<=35
actions+=/vile_taint,if=time<15
actions+=/dark_soul,if=cooldown.summon_darkglare.remains<10&dot.phantom_singularity.remains|target.time_to_die<20+gcd|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up
actions+=/berserking
actions+=/call_action_list,name=spenders
actions+=/call_action_list,name=fillers

actions.cooldowns=potion,if=(talent.dark_soul_misery.enabled&cooldown.summon_darkglare.up&cooldown.dark_soul.up)|cooldown.summon_darkglare.up|target.time_to_die<30
actions.cooldowns+=/use_items,if=!cooldown.summon_darkglare.up,if=cooldown.summon_darkglare.remains>70|time_to_die<20|((buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains)&!cooldown.summon_darkglare.remains)
actions.cooldowns+=/fireblood,if=!cooldown.summon_darkglare.up
actions.cooldowns+=/blood_fury,if=!cooldown.summon_darkglare.up

actions.db_refresh=siphon_life,line_cd=15,if=(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.corruption.remains%dot.corruption.duration)&dot.siphon_life.remains<dot.siphon_life.duration*1.3
actions.db_refresh+=/agony,line_cd=15,if=(dot.agony.remains%dot.agony.duration)<=(dot.corruption.remains%dot.corruption.duration)&(dot.agony.remains%dot.agony.duration)<=(dot.siphon_life.remains%dot.siphon_life.duration)&dot.agony.remains<dot.agony.duration*1.3
actions.db_refresh+=/corruption,line_cd=15,if=(dot.corruption.remains%dot.corruption.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.corruption.remains%dot.corruption.duration)<=(dot.siphon_life.remains%dot.siphon_life.duration)&dot.corruption.remains<dot.corruption.duration*1.3

actions.dots=seed_of_corruption,if=dot.corruption.remains<=action.seed_of_corruption.cast_time+time_to_shard+4.2*(1-talent.creeping_death.enabled*0.15)&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&!dot.seed_of_corruption.remains&!action.seed_of_corruption.in_flight
actions.dots+=/agony,target_if=min:remains,if=talent.creeping_death.enabled&active_dot.agony<6&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
actions.dots+=/agony,target_if=min:remains,if=!talent.creeping_death.enabled&active_dot.agony<8&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
actions.dots+=/siphon_life,target_if=min:remains,if=(active_dot.siphon_life<8-talent.creeping_death.enabled-spell_targets.sow_the_seeds_aoe)&target.time_to_die>10&refreshable&(!remains&spell_targets.seed_of_corruption_aoe=1|cooldown.summon_darkglare.remains>soul_shard*action.unstable_affliction.execute_time)
actions.dots+=/corruption,cycle_targets=1,if=spell_targets.seed_of_corruption_aoe<3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)&target.time_to_die>10

actions.fillers=unstable_affliction,line_cd=15,if=cooldown.deathbolt.remains<=gcd*2&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains>20
actions.fillers+=/call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&(dot.agony.remains<dot.agony.duration*0.75|dot.corruption.remains<dot.corruption.duration*0.75|dot.siphon_life.remains<dot.siphon_life.duration*0.75)&cooldown.deathbolt.remains<=action.agony.gcd*4&cooldown.summon_darkglare.remains>20
actions.fillers+=/call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains<=soul_shard*action.agony.gcd+action.agony.gcd*3&(dot.agony.remains<dot.agony.duration*1|dot.corruption.remains<dot.corruption.duration*1|dot.siphon_life.remains<dot.siphon_life.duration*1)
actions.fillers+=/deathbolt,if=cooldown.summon_darkglare.remains>=30+gcd|cooldown.summon_darkglare.remains>140
actions.fillers+=/shadow_bolt,if=buff.movement.up&buff.nightfall.remains
actions.fillers+=/agony,if=buff.movement.up&!(talent.siphon_life.enabled&(prev_gcd.1.agony&prev_gcd.2.agony&prev_gcd.3.agony)|prev_gcd.1.agony)
actions.fillers+=/siphon_life,if=buff.movement.up&!(prev_gcd.1.siphon_life&prev_gcd.2.siphon_life&prev_gcd.3.siphon_life)
actions.fillers+=/corruption,if=buff.movement.up&!prev_gcd.1.corruption&!talent.absolute_corruption.enabled
actions.fillers+=/drain_life,if=(buff.inevitable_demise.stack>=85-(spell_targets.seed_of_corruption_aoe-raid_event.invulnerable.up>2)*20&(cooldown.deathbolt.remains>execute_time|!talent.deathbolt.enabled)&(cooldown.phantom_singularity.remains>execute_time|!talent.phantom_singularity.enabled)&(cooldown.dark_soul.remains>execute_time|!talent.dark_soul_misery.enabled)&(cooldown.vile_taint.remains>execute_time|!talent.vile_taint.enabled)&cooldown.summon_darkglare.remains>execute_time+10|buff.inevitable_demise.stack>30&target.time_to_die<=10)
actions.fillers+=/haunt
actions.fillers+=/drain_soul,interrupt_global=1,chain=1,interrupt=1,cycle_targets=1,if=target.time_to_die<=gcd
actions.fillers+=/drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains
actions.fillers+=/drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se
actions.fillers+=/drain_soul,interrupt_global=1,chain=1,interrupt=1
actions.fillers+=/shadow_bolt,cycle_targets=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains&!action.shadow_bolt.in_flight
actions.fillers+=/shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se
actions.fillers+=/shadow_bolt

actions.spenders=unstable_affliction,if=cooldown.summon_darkglare.remains<=soul_shard*execute_time&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=soul_shard*execute_time)
actions.spenders+=/call_action_list,name=fillers,if=(cooldown.summon_darkglare.remains<time_to_shard*(6-soul_shard)|cooldown.summon_darkglare.up)&time_to_die>cooldown.summon_darkglare.remains
actions.spenders+=/seed_of_corruption,if=variable.use_seed
actions.spenders+=/unstable_affliction,if=!variable.use_seed&!prev_gcd.1.summon_darkglare&(talent.deathbolt.enabled&cooldown.deathbolt.remains<=execute_time&!azerite.cascading_calamity.enabled|(soul_shard>=5&spell_targets.seed_of_corruption_aoe<2|soul_shard>=2&spell_targets.seed_of_corruption_aoe>=2)&target.time_to_die>4+execute_time&spell_targets.seed_of_corruption_aoe=1|target.time_to_die<=8+execute_time*soul_shard)
actions.spenders+=/unstable_affliction,if=!variable.use_seed&contagion<=cast_time+variable.padding
actions.spenders+=/unstable_affliction,cycle_targets=1,if=!variable.use_seed&(!talent.deathbolt.enabled|cooldown.deathbolt.remains>time_to_shard|soul_shard>1)&(!talent.vile_taint.enabled|soul_shard>1)&contagion<=cast_time+variable.padding&(!azerite.cascading_calamity.enabled|buff.cascading_calamity.remains>time_to_shard)

head=visage_of_the_ascended_prophet,id=160719,bonus_id=4824/1507/4775,azerite_powers=483/21/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=mantle_of_contained_corruption,id=160613,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=ring_of_the_infinite_void,id=160647,bonus_id=4800/1507,enchant=pact_of_mastery
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_mastery
trinket1=balefire_branch,id=159630,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=masterful_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5205
# gear_crit_rating=802
# gear_haste_rating=1014
# gear_mastery_rating=1220
# gear_versatility_rating=129
# gear_armor=1165
default_pet=succubus

Drain_Soul : 16234 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16234.2 16234.2 4.9 / 0.030% 1550.2 / 9.5% 15.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
871.9 863.6 Mana 0.00% 36.2 100.0% 100%
Talents
  • 15: Drain Soul (Affliction Warlock)
  • 30: Siphon Life (Affliction Warlock)
  • 60: Phantom Singularity
  • 90: Haunt (Affliction Warlock)
  • 100: Dark Soul: Misery (Affliction Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Drain_Soul 16234
Agony 1469 9.1% 16.0 18.61sec 27573 22661 Periodic 192.1 1969 3940 2293 16.4% 99.6%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.98 0.00 192.15 192.15 1.2168 1.5544 440638.90 440638.90 0.00 1385.16 22660.78
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 160.6 83.56% 1969.23 1 3075 1968.78 1904 2025 316168 316168 0.00
crit 31.6 16.44% 3939.79 3 6150 3939.11 3284 4350 124471 124471 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=gcd+action.shadow_bolt.execute_time&target.time_to_die>8
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.008000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Corruption 1664 10.3% 20.1 14.71sec 24847 20681 Periodic 190.3 2251 4504 2622 16.4% 98.1%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.08 0.00 190.33 190.33 1.2015 1.5465 498971.01 498971.01 0.00 1566.76 20681.02
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 159.0 83.56% 2251.49 1 3459 2251.49 2184 2316 358086 358086 0.00
crit 31.3 16.44% 4503.76 3 6919 4503.86 4071 4939 140885 140885 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.090000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 2729 16.8% 66.8 4.39sec 12236 5226 Periodic 184.7 3801 7606 4428 16.5% 47.5%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.84 0.00 184.71 184.71 2.3414 0.7722 817874.75 817874.75 0.00 5225.77 5225.77
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 154.3 83.53% 3801.44 2381 8328 3801.71 3538 4147 586536 586536 0.00
crit 30.4 16.47% 7606.29 4843 16656 7607.04 6030 10118 231339 231339 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die<=gcd&soul_shard<5
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=5 seconds}. Damage is increased by {$s2=100}% against enemies below {$s3=20}% health. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.210000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Haunt 526 3.2% 17.4 16.81sec 9073 7533 Direct 18.3 7390 14783 8607 16.5%  

Stats details: haunt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.39 18.34 0.00 0.00 1.2044 0.0000 157823.36 157823.36 0.00 7533.33 7533.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.32 83.54% 7390.18 6235 10906 7391.00 6759 7927 113197 113197 0.00
crit 3.02 16.46% 14782.71 12470 21812 14154.33 0 21164 44626 44626 0.00
 
 

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:48181
  • name:Haunt
  • school:shadow
  • tooltip:Taking {$s2=10}% increased damage from the Warlock. Haunt's cooldown will be reset on death.
  • description:A ghostly soul haunts the target, dealing {$s1=0} Shadow damage and increasing your damage dealt to the target by {$s2=10}% for {$d=15 seconds}. If the target dies, Haunt's cooldown is reset.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25
 
Heed My Call 159 (227) 1.0% (1.4%) 7.1 38.07sec 9636 0 Direct 7.1 5796 11590 6744 16.4%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.06 7.06 0.00 0.00 0.0000 0.0000 47623.59 47623.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.91 83.65% 5796.43 4925 6141 5791.04 0 6141 34242 34242 0.00
crit 1.15 16.35% 11589.53 9849 12282 8031.89 0 12282 13382 13382 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 68 0.4% 7.1 38.07sec 2893 0 Direct 7.1 2484 4968 2893 16.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.06 7.06 0.00 0.00 0.0000 0.0000 20428.93 20428.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.90 83.55% 2484.09 2111 2632 2482.05 0 2632 14656 14656 0.00
crit 1.16 16.45% 4967.87 4221 5264 3456.29 0 5264 5773 5773 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
  • base_dd_mult:1.00
 
Phantom Singularity 1102 6.8% 6.7 45.89sec 49009 39986 Periodic 70.0 4706 0 4706 0.0% 34.5%

Stats details: phantom_singularity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.72 0.00 70.03 70.03 1.2258 1.4793 329523.14 329523.14 0.00 2946.59 39985.82
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.0 100.00% 4705.62 4 6919 4706.91 4476 4996 329523 329523 0.00
 
 

Action details: phantom_singularity

Static Values
  • id:205179
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time>35&(cooldown.summon_darkglare.remains>=45|cooldown.summon_darkglare.remains<8)&target.time_to_die>16*spell_haste
Spelldata
  • id:205179
  • name:Phantom Singularity
  • school:shadow
  • tooltip:Dealing damage to all nearby targets every $t1 sec and healing the casting Warlock.
  • description:Places a phantom singularity above the target, which consumes the life of all enemies within $205246A2 yards, dealing ${8*{$205246s2=0 + 18.0%}} damage over {$d=16 seconds}, healing you for ${$205246e2*100}% of the damage done.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 

Action details: phantom_singularity_tick

Static Values
  • id:205246
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205246
  • name:Phantom Singularity
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205179=Places a phantom singularity above the target, which consumes the life of all enemies within $205246A2 yards, dealing ${8*{$205246s2=0 + 18.0%}} damage over {$d=16 seconds}, healing you for ${$205246e2*100}% of the damage done.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.180000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25
 
Siphon Life 1483 9.1% 18.9 15.73sec 23557 19673 Periodic 127.6 2992 5983 3484 16.5% 98.6%

Stats details: siphon_life

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.87 0.00 127.61 127.61 1.1975 2.3175 444605.73 444605.73 0.00 1396.67 19672.82
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.6 83.54% 2991.74 1 4613 2991.50 2863 3092 318930 318930 0.00
crit 21.0 16.46% 5983.42 2 9225 5983.57 5154 6686 125675 125675 0.00
 
 

Action details: siphon_life

Static Values
  • id:63106
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.corruption.remains%dot.corruption.duration)&dot.siphon_life.remains<dot.siphon_life.duration*1.3
Spelldata
  • id:63106
  • name:Siphon Life
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and siphoning life to the casting Warlock.
  • description:Siphons the target's life essence, dealing $o1 Shadow damage over {$d=15 seconds} and healing you for ${$e1*100}% of the damage done.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.120000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Unstable Affliction 0 (3637) 0.0% (22.4%) 38.1 7.79sec 28519 25079

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.12 0.00 0.00 0.00 1.1372 0.0000 0.00 0.00 0.00 25078.90 25078.90
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
 
    Unstable Affliction (_1) 1692 10.4% 0.0 0.00sec 0 0 Periodic 106.0 4111 8222 4788 16.5% 57.2%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 106.04 106.04 0.0000 1.6175 507764.56 507764.56 0.00 2960.35 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.6 83.52% 4111.22 2 6150 4111.63 3968 4260 364124 364124 0.00
crit 17.5 16.48% 8221.52 14 12300 8222.56 6787 9263 143640 143640 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 1104 6.8% 0.0 0.00sec 0 0 Periodic 68.4 4150 8300 4832 16.4% 37.4%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 68.38 68.38 0.0000 1.6399 330429.85 330429.85 0.00 2946.64 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.1 83.56% 4149.98 7 6150 4152.64 3955 4468 237135 237135 0.00
crit 11.2 16.44% 8300.46 15 12300 8305.36 0 10009 93295 93295 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 329 2.0% 0.0 0.00sec 0 0 Periodic 18.1 4635 9271 5399 16.5% 10.7%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 18.06 18.06 0.0000 1.7744 97488.25 97488.25 0.00 3042.51 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.1 83.53% 4635.45 516 6150 4635.82 4267 5068 69924 69924 0.00
crit 3.0 16.47% 9270.64 1455 12300 8897.28 0 12016 27565 27565 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 309 1.9% 0.0 0.00sec 0 0 Periodic 17.0 4621 9241 5378 16.4% 10.0%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 17.02 17.02 0.0000 1.7665 91557.32 91557.32 0.00 3044.60 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.2 83.61% 4620.55 3716 6150 4618.86 4151 5271 65765 65765 0.00
crit 2.8 16.39% 9241.02 7257 12205 8757.69 0 11935 25793 25793 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 203 1.2% 0.0 0.00sec 0 0 Periodic 11.0 4678 9346 5440 16.3% 6.2%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 11.03 11.03 0.0000 1.6797 60005.37 60005.37 0.00 3238.81 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.2 83.67% 4678.02 3514 6103 4600.39 0 5515 43170 43170 0.00
crit 1.8 16.33% 9345.64 7311 12205 7689.18 0 12205 16835 16835 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Volatile Blood Explosion 325 2.0% 7.1 37.94sec 13841 0 Direct 7.0 12051 24100 14046 16.6%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.05 6.95 0.00 0.00 0.0000 0.0000 97637.79 97637.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.80 83.44% 12051.23 10240 12770 12041.76 0 12770 69902 69902 0.00
crit 1.15 16.56% 24099.89 20481 25540 16634.29 0 25540 27736 27736 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies. Deals increased damage when striking multiple targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
  • base_dd_mult:1.00
 
pet - darkglare 5749 / 777
Eye Beam (dark_glare) 5749 4.7% 31.6 6.71sec 7273 5949 Direct 31.6 6245 12488 7273 16.5%  

Stats details: dark_glare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.62 31.62 0.00 0.00 1.2224 0.0000 229946.54 229946.54 0.00 5949.30 5949.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.41 83.54% 6244.99 3792 7971 6245.56 5683 6801 164956 164956 0.00
crit 5.20 16.46% 12488.10 7584 15942 12456.18 0 15942 64991 64991 0.00
 
 

Action details: dark_glare

Static Values
  • id:205231
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205231
  • name:Eye Beam
  • school:shadow
  • tooltip:
  • description:Fires an eye beam that deals {$s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.256000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
 
pet - succubus 2296 / 2296
Lash of Pain 1083 6.7% 64.5 4.74sec 5032 6105 Direct 64.5 4322 8644 5032 16.4%  

Stats details: lash_of_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.51 64.51 0.00 0.00 0.8242 0.0000 324645.92 324645.92 0.00 6105.35 6105.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.91 83.57% 4322.23 3889 5698 4322.27 4222 4418 233025 233025 0.00
crit 10.60 16.43% 8643.96 7778 11396 8644.19 7934 10182 91621 91621 0.00
 
 

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:7814
  • name:Lash of Pain
  • school:shadow
  • tooltip:
  • description:Lashes the target, dealing {$s1=0} Shadow damage. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
 
melee 1213 7.5% 123.8 2.43sec 2938 1218 Direct 123.8 2523 5045 2938 16.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.81 123.81 0.00 0.00 2.4128 0.0000 363749.66 520023.82 30.05 1217.63 1217.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 103.42 83.53% 2522.52 2267 3321 2522.55 2482 2564 260889 372972 30.05
crit 20.39 16.47% 5044.60 4534 6643 5044.74 4751 5576 102861 147052 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Drain_Soul
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Drain_Soul
  • harmful:false
  • if_expr:
 
Dark Soul: Misery (dark_soul) 2.4 168.76sec

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.41 0.00 0.00 0.00 1.1540 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dark_soul

Static Values
  • id:113860
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_darkglare.remains<10&dot.phantom_singularity.remains|target.time_to_die<20+gcd|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up
Spelldata
  • id:113860
  • name:Dark Soul: Misery
  • school:shadow
  • tooltip:Haste increased by {$s1=30}%.
  • description:Infuses your soul with the misery of fallen foes, increasing haste by {$s1=30}% for {$d=20 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Drain_Soul
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Drain_Soul
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Darkglare 2.0 187.54sec

Stats details: summon_darkglare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8998 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_darkglare

Static Values
  • id:205180
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.agony.ticking&dot.corruption.ticking&(buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up)
Spelldata
  • id:205180
  • name:Summon Darkglare
  • school:shadow
  • tooltip:Summons a Darkglare from the Twisting Nether that blasts its target for Shadow damage, dealing increased damage for every damage over time effect you have active on any target.
  • description:Summons a Darkglare from the Twisting Nether that extends the duration of your damage over time effects on all enemies by {$s2=8} sec. The Darkglare will serve you for {$d=20 seconds}, blasting its target for {$205231s1=0} Shadow damage, increased by {$s3=10}% for every damage over time effect you have active on any target.
 
Summon Succubus 1.0 0.00sec

Stats details: summon_succubus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_succubus

Static Values
  • id:712
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:712
  • name:Summon Succubus
  • school:shadow
  • tooltip:
  • description:Summons a Succubus under your command to seduce enemy Humanoids, preventing them from attacking.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
active_uas 19.1 18.5 15.7sec 0.0sec 76.23% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • active_uas_1:54.81%
  • active_uas_2:10.99%
  • active_uas_3:1.63%
  • active_uas_4:3.45%
  • active_uas_5:5.35%
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:42.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dark Soul: Misery (dark_soul) 2.4 0.0 168.8sec 168.8sec 15.44% 0.00% 0.0(0.0) 2.1

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dark_soul_1:15.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:113860
  • name:Dark Soul: Misery
  • tooltip:Haste increased by {$s1=30}%.
  • description:Infuses your soul with the misery of fallen foes, increasing haste by {$s1=30}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.5 0.2 73.7sec 65.4sec 8.68% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_crit_1:8.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 73.8sec 65.4sec 8.72% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_haste_1:8.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.6 0.2 73.4sec 65.1sec 8.81% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_mastery_1:8.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 74.3sec 65.9sec 8.76% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_versatility_1:8.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 93.0sec 93.0sec 23.51% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Buff details

  • stat:intellect
  • amount:16.00

Stack Uptimes

  • kindled_soul_5:1.15%
  • kindled_soul_10:1.15%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.16%
  • kindled_soul_25:1.16%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.17%
  • kindled_soul_40:1.17%
  • kindled_soul_45:1.17%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.18%
  • kindled_soul_60:1.18%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.19%
  • kindled_soul_75:1.19%
  • kindled_soul_80:1.19%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.20%
  • kindled_soul_95:1.20%
  • kindled_soul_100:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by $w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining ${$268998U1*{$268998s1=9}} Intellect, which decays over $D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Masterful Navigation 6.0 22.4 52.1sec 10.3sec 66.86% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_masterful_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:50.00

Stack Uptimes

  • masterful_navigation_1:17.49%
  • masterful_navigation_2:16.97%
  • masterful_navigation_3:16.44%
  • masterful_navigation_4:15.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268899
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Masterful Navigation (_final) 5.4 0.0 52.1sec 52.1sec 17.50% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_masterful_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:600.00

Stack Uptimes

  • masterful_navigation_final_1:17.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268898
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.6 68.1sec 38.8sec 42.66% 0.00% 2.6(36.1) 0.0

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.28%
  • overwhelming_power_2:1.31%
  • overwhelming_power_3:1.34%
  • overwhelming_power_4:1.37%
  • overwhelming_power_5:1.41%
  • overwhelming_power_6:1.44%
  • overwhelming_power_7:1.48%
  • overwhelming_power_8:1.52%
  • overwhelming_power_9:1.56%
  • overwhelming_power_10:1.59%
  • overwhelming_power_11:1.64%
  • overwhelming_power_12:1.68%
  • overwhelming_power_13:1.72%
  • overwhelming_power_14:1.77%
  • overwhelming_power_15:1.81%
  • overwhelming_power_16:1.86%
  • overwhelming_power_17:1.91%
  • overwhelming_power_18:1.96%
  • overwhelming_power_19:2.01%
  • overwhelming_power_20:2.06%
  • overwhelming_power_21:2.12%
  • overwhelming_power_22:2.17%
  • overwhelming_power_23:2.23%
  • overwhelming_power_24:2.28%
  • overwhelming_power_25:1.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Drain_Soul
agony Mana 16.0 15981.1 1000.0 1000.0 27.6
corruption Mana 20.1 20081.8 1000.0 1000.0 24.8
drain_soul Mana 184.7 184707.9 1000.0 2763.3 4.4
haunt Mana 18.4 36789.7 2000.0 2115.0 4.3
summon_darkglare Mana 2.0 4000.0 2000.0 2000.0 0.0
unstable_affliction Soul Shard 38.1 38.1 1.0 1.0 28519.2
pet - succubus
lash_of_pain Energy 64.5 3870.8 60.0 60.0 83.9
Resource Gains Type Count Total Average Overflow
drain_soul Soul Shard 1.00 1.00 (2.68%) 1.00 0.00 0.00%
agony Soul Shard 35.34 35.34 (94.90%) 1.00 0.00 0.00%
mana_regen Mana 636.62 259067.51 (100.00%) 406.94 40616.32 13.55%
unstable_affliction_refund Soul Shard 0.90 0.90 (2.42%) 1.00 0.00 0.00%
pet - darkglare
energy_regen Energy 31.62 0.00 (0.00%) 0.00 529.85 100.00%
pet - succubus
energy_regen Energy 2654.38 3699.99 (100.00%) 1.39 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 863.55 871.86
Soul Shard 0.12 0.13
Combat End Resource Mean Min Max
Mana 97503.40 91425.00 100000.00
Soul Shard 2.12 0.00 3.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 9.8%

Statistics & Data Analysis

Fight Length
Sample Data Drain_Soul Fight Length
Count 24999
Mean 300.00
Minimum 240.01
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data Drain_Soul Damage Per Second
Count 24999
Mean 16234.19
Minimum 15108.82
Maximum 17937.24
Spread ( max - min ) 2828.42
Range [ ( max - min ) / 2 * 100% ] 8.71%
Standard Deviation 395.6688
5th Percentile 15657.90
95th Percentile 16967.20
( 95th Percentile - 5th Percentile ) 1309.30
Mean Distribution
Standard Deviation 2.5025
95.00% Confidence Intervall ( 16229.28 - 16239.09 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2282
0.1 Scale Factor Error with Delta=300 1337
0.05 Scale Factor Error with Delta=300 5346
0.01 Scale Factor Error with Delta=300 133644
Priority Target DPS
Sample Data Drain_Soul Priority Target Damage Per Second
Count 24999
Mean 16234.19
Minimum 15108.82
Maximum 17937.24
Spread ( max - min ) 2828.42
Range [ ( max - min ) / 2 * 100% ] 8.71%
Standard Deviation 395.6688
5th Percentile 15657.90
95th Percentile 16967.20
( 95th Percentile - 5th Percentile ) 1309.30
Mean Distribution
Standard Deviation 2.5025
95.00% Confidence Intervall ( 16229.28 - 16239.09 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2282
0.1 Scale Factor Error with Delta=300 1337
0.05 Scale Factor Error with Delta=300 5346
0.01 Scale Factor Error with Delta=300 133644
DPS(e)
Sample Data Drain_Soul Damage Per Second (Effective)
Count 24999
Mean 16234.19
Minimum 15108.82
Maximum 17937.24
Spread ( max - min ) 2828.42
Range [ ( max - min ) / 2 * 100% ] 8.71%
Damage
Sample Data Drain_Soul Damage
Count 24999
Mean 3942372.56
Minimum 3068307.43
Maximum 4925779.84
Spread ( max - min ) 1857472.41
Range [ ( max - min ) / 2 * 100% ] 23.56%
DTPS
Sample Data Drain_Soul Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Drain_Soul Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Drain_Soul Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Drain_Soul Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Drain_Soul Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Drain_Soul Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Drain_SoulTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Drain_Soul Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 seed_of_corruption,if=spell_targets.seed_of_corruption_aoe>=3
8 0.00 haunt
9 0.00 shadow_bolt,if=!talent.haunt.enabled&spell_targets.seed_of_corruption_aoe<3
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=use_seed,value=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up|talent.siphon_life.enabled&spell_targets.seed_of_corruption>=5+raid_event.invulnerable.up|spell_targets.seed_of_corruption>=8+raid_event.invulnerable.up
0.00 variable,name=padding,op=set,value=action.shadow_bolt.execute_time*azerite.cascading_calamity.enabled
0.00 variable,name=padding,op=reset,value=gcd,if=azerite.cascading_calamity.enabled&(talent.drain_soul.enabled|talent.deathbolt.enabled&cooldown.deathbolt.remains<=gcd)
0.00 variable,name=maintain_se,value=spell_targets.seed_of_corruption_aoe<=1+talent.writhe_in_agony.enabled+talent.absolute_corruption.enabled*2+(talent.writhe_in_agony.enabled&talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>2)+(talent.siphon_life.enabled&!talent.creeping_death.enabled&!talent.drain_soul.enabled)+raid_event.invulnerable.up
A 0.00 call_action_list,name=cooldowns
B 0.25 drain_soul,interrupt_global=1,chain=1,cycle_targets=1,if=target.time_to_die<=gcd&soul_shard<5
C 17.40 haunt,if=spell_targets.seed_of_corruption_aoe<=2+raid_event.invulnerable.up
D 2.00 summon_darkglare,if=dot.agony.ticking&dot.corruption.ticking&(buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up)
0.00 deathbolt,if=cooldown.summon_darkglare.remains&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up
E 2.47 agony,target_if=min:dot.agony.remains,if=remains<=gcd+action.shadow_bolt.execute_time&target.time_to_die>8
F 0.18 unstable_affliction,target_if=!contagion&target.time_to_die<=8
0.00 drain_soul,target_if=min:debuff.shadow_embrace.remains,cancel_if=ticks_remain<5,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=gcd*2
0.00 shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=execute_time*2+travel_time&!action.shadow_bolt.in_flight
G 5.72 phantom_singularity,target_if=max:target.time_to_die,if=time>35&(cooldown.summon_darkglare.remains>=45|cooldown.summon_darkglare.remains<8)&target.time_to_die>16*spell_haste
0.00 vile_taint,target_if=max:target.time_to_die,if=time>15&target.time_to_die>=10
H 0.11 unstable_affliction,target_if=min:contagion,if=!variable.use_seed&soul_shard=5
0.00 seed_of_corruption,if=variable.use_seed&soul_shard=5
I 0.00 call_action_list,name=dots
J 1.00 phantom_singularity,if=time<=35
0.00 vile_taint,if=time<15
K 2.41 dark_soul,if=cooldown.summon_darkglare.remains<10&dot.phantom_singularity.remains|target.time_to_die<20+gcd|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up
0.00 berserking
L 0.00 call_action_list,name=spenders
M 0.00 call_action_list,name=fillers
actions.cooldowns
# count action,conditions
N 1.00 potion,if=(talent.dark_soul_misery.enabled&cooldown.summon_darkglare.up&cooldown.dark_soul.up)|cooldown.summon_darkglare.up|target.time_to_die<30
O 3.61 use_items,if=!cooldown.summon_darkglare.up,if=cooldown.summon_darkglare.remains>70|time_to_die<20|((buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains)&!cooldown.summon_darkglare.remains)
0.00 fireblood,if=!cooldown.summon_darkglare.up
0.00 blood_fury,if=!cooldown.summon_darkglare.up
actions.dots
# count action,conditions
0.00 seed_of_corruption,if=dot.corruption.remains<=action.seed_of_corruption.cast_time+time_to_shard+4.2*(1-talent.creeping_death.enabled*0.15)&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&!dot.seed_of_corruption.remains&!action.seed_of_corruption.in_flight
0.00 agony,target_if=min:remains,if=talent.creeping_death.enabled&active_dot.agony<6&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
P 13.51 agony,target_if=min:remains,if=!talent.creeping_death.enabled&active_dot.agony<8&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
Q 18.87 siphon_life,target_if=min:remains,if=(active_dot.siphon_life<8-talent.creeping_death.enabled-spell_targets.sow_the_seeds_aoe)&target.time_to_die>10&refreshable&(!remains&spell_targets.seed_of_corruption_aoe=1|cooldown.summon_darkglare.remains>soul_shard*action.unstable_affliction.execute_time)
R 20.08 corruption,cycle_targets=1,if=spell_targets.seed_of_corruption_aoe<3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)&target.time_to_die>10
actions.fillers
# count action,conditions
S 13.06 unstable_affliction,line_cd=15,if=cooldown.deathbolt.remains<=gcd*2&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains>20
T 0.00 call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&(dot.agony.remains<dot.agony.duration*0.75|dot.corruption.remains<dot.corruption.duration*0.75|dot.siphon_life.remains<dot.siphon_life.duration*0.75)&cooldown.deathbolt.remains<=action.agony.gcd*4&cooldown.summon_darkglare.remains>20
U 0.00 call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains<=soul_shard*action.agony.gcd+action.agony.gcd*3&(dot.agony.remains<dot.agony.duration*1|dot.corruption.remains<dot.corruption.duration*1|dot.siphon_life.remains<dot.siphon_life.duration*1)
0.00 deathbolt,if=cooldown.summon_darkglare.remains>=30+gcd|cooldown.summon_darkglare.remains>140
0.00 shadow_bolt,if=buff.movement.up&buff.nightfall.remains
0.00 agony,if=buff.movement.up&!(talent.siphon_life.enabled&(prev_gcd.1.agony&prev_gcd.2.agony&prev_gcd.3.agony)|prev_gcd.1.agony)
0.00 siphon_life,if=buff.movement.up&!(prev_gcd.1.siphon_life&prev_gcd.2.siphon_life&prev_gcd.3.siphon_life)
0.00 corruption,if=buff.movement.up&!prev_gcd.1.corruption&!talent.absolute_corruption.enabled
0.00 drain_life,if=(buff.inevitable_demise.stack>=85-(spell_targets.seed_of_corruption_aoe-raid_event.invulnerable.up>2)*20&(cooldown.deathbolt.remains>execute_time|!talent.deathbolt.enabled)&(cooldown.phantom_singularity.remains>execute_time|!talent.phantom_singularity.enabled)&(cooldown.dark_soul.remains>execute_time|!talent.dark_soul_misery.enabled)&(cooldown.vile_taint.remains>execute_time|!talent.vile_taint.enabled)&cooldown.summon_darkglare.remains>execute_time+10|buff.inevitable_demise.stack>30&target.time_to_die<=10)
0.00 haunt
0.00 drain_soul,interrupt_global=1,chain=1,interrupt=1,cycle_targets=1,if=target.time_to_die<=gcd
0.00 drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains
0.00 drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se
V 54.37 drain_soul,interrupt_global=1,chain=1,interrupt=1
0.00 shadow_bolt,cycle_targets=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains&!action.shadow_bolt.in_flight
0.00 shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se
0.00 shadow_bolt
actions.spenders
# count action,conditions
W 8.48 unstable_affliction,if=cooldown.summon_darkglare.remains<=soul_shard*execute_time&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=soul_shard*execute_time)
X 0.00 call_action_list,name=fillers,if=(cooldown.summon_darkglare.remains<time_to_shard*(6-soul_shard)|cooldown.summon_darkglare.up)&time_to_die>cooldown.summon_darkglare.remains
0.00 seed_of_corruption,if=variable.use_seed
Y 0.95 unstable_affliction,if=!variable.use_seed&!prev_gcd.1.summon_darkglare&(talent.deathbolt.enabled&cooldown.deathbolt.remains<=execute_time&!azerite.cascading_calamity.enabled|(soul_shard>=5&spell_targets.seed_of_corruption_aoe<2|soul_shard>=2&spell_targets.seed_of_corruption_aoe>=2)&target.time_to_die>4+execute_time&spell_targets.seed_of_corruption_aoe=1|target.time_to_die<=8+execute_time*soul_shard)
Z 15.35 unstable_affliction,if=!variable.use_seed&contagion<=cast_time+variable.padding
0.00 unstable_affliction,cycle_targets=1,if=!variable.use_seed&(!talent.deathbolt.enabled|cooldown.deathbolt.remains>time_to_shard|soul_shard>1)&(!talent.vile_taint.enabled|soul_shard>1)&contagion<=cast_time+variable.padding&(!azerite.cascading_calamity.enabled|buff.cascading_calamity.remains>time_to_shard)

Sample Sequence

012368EQRJKWWWWWODVCSVQPRVZVCSRQVPVZVCGQRZSVPVRCQZVSVPRVQCZVSVRVPGQCOZVSVRVQPZCVRVZVQVPCVRZVSVGQVCPRVVQSVRVCPVVQVRVVVCVVEGKNQWRWWWWODCVSVPQRZCVSVQRPZVCGVSVQRVPZCVSRQVZVCPRSQVZGVCPRQZOVYVCB

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Drain_Soul 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Drain_Soul 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation Drain_Soul 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_succubus Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 8 haunt Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 default E agony Fluffy_Pillow 98000.0/100000: 98% mana | 3.0/5: 60% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.297 dots Q siphon_life Fluffy_Pillow 98297.0/100000: 98% mana | 3.0/5: 60% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:02.295 dots R corruption Fluffy_Pillow 99295.0/100000: 99% mana | 4.0/5: 80% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:03.294 default J phantom_singularity Fluffy_Pillow 99294.0/100000: 99% mana | 4.0/5: 80% soul_shard bloodlust, overwhelming_power(25), archive_of_the_titans, battle_potion_of_intellect
0:04.219 default K dark_soul Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, overwhelming_power(24), archive_of_the_titans, battle_potion_of_intellect
0:05.148 spenders W unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, dark_soul, overwhelming_power(23), archive_of_the_titans(2), battle_potion_of_intellect
0:05.903 spenders W unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, active_uas, dark_soul, overwhelming_power(23), archive_of_the_titans(2), battle_potion_of_intellect
0:06.657 spenders W unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), dark_soul, overwhelming_power(22), archive_of_the_titans(2), battle_potion_of_intellect
0:07.412 spenders W unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(3), dark_soul, overwhelming_power(21), archive_of_the_titans(2), battle_potion_of_intellect
0:08.165 spenders W unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, overwhelming_power(20), archive_of_the_titans(2), battle_potion_of_intellect
0:08.919 cooldowns O use_items Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, overwhelming_power(20), archive_of_the_titans(2), battle_potion_of_intellect
0:08.919 default D summon_darkglare Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, overwhelming_power(20), archive_of_the_titans(2), battle_potion_of_intellect, kindled_soul(100)
0:09.674 fillers V drain_soul Fluffy_Pillow 98755.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, overwhelming_power(19), archive_of_the_titans(2), battle_potion_of_intellect, kindled_soul(100)
0:15.424 default C haunt Fluffy_Pillow 93505.0/100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation, overwhelming_power(13), archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(70)
0:16.191 fillers S unstable_affliction Fluffy_Pillow 92272.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation, overwhelming_power(12), archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(65)
0:16.959 fillers V drain_soul Fluffy_Pillow 93040.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation, overwhelming_power(12), archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(60)
0:20.265 dots Q siphon_life Fluffy_Pillow 90346.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(2), overwhelming_power(8), archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(45)
0:21.043 dots P agony Fluffy_Pillow 91124.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(2), overwhelming_power(7), archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(40)
0:21.826 dots R corruption Fluffy_Pillow 90907.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(2), elemental_whirl_crit, overwhelming_power(7), archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(40)
0:22.608 fillers V drain_soul Fluffy_Pillow 90689.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(2), elemental_whirl_crit, overwhelming_power(6), archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(35)
0:26.918 spenders Z unstable_affliction Fluffy_Pillow 87999.0/100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(2), elemental_whirl_crit, overwhelming_power(2), archive_of_the_titans(6), kindled_soul(15)
0:27.910 fillers V drain_soul Fluffy_Pillow 88991.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(2), elemental_whirl_crit, overwhelming_power, archive_of_the_titans(6), kindled_soul(10)
0:32.104 default C haunt Fluffy_Pillow 87185.0/100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(2), archive_of_the_titans(7)
0:33.102 fillers S unstable_affliction Fluffy_Pillow 86183.0/100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation(2), archive_of_the_titans(7)
0:34.103 dots R corruption Fluffy_Pillow 87184.0/100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), masterful_navigation(2), archive_of_the_titans(7)
0:35.101 dots Q siphon_life Fluffy_Pillow 87182.0/100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), masterful_navigation(2), archive_of_the_titans(8)
0:36.100 fillers V drain_soul Fluffy_Pillow 88181.0/100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(2), archive_of_the_titans(8)
0:39.081 dots P agony Fluffy_Pillow 87162.0/100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(3), archive_of_the_titans(8)
0:40.080 fillers V drain_soul Fluffy_Pillow 87161.0/100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(3), archive_of_the_titans(9)
0:41.587 spenders Z unstable_affliction Fluffy_Pillow 86668.0/100000: 87% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(9)
0:42.883 fillers V drain_soul Fluffy_Pillow 87964.0/100000: 88% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(9)
0:48.247 default C haunt Fluffy_Pillow 87328.0/100000: 87% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(10)
0:49.544 default G phantom_singularity Fluffy_Pillow 86625.0/100000: 87% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(10)
0:50.840 dots Q siphon_life Fluffy_Pillow 87921.0/100000: 88% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(11)
0:52.136 dots R corruption Fluffy_Pillow 89217.0/100000: 89% mana | 2.0/5: 40% soul_shard masterful_navigation(4), archive_of_the_titans(11)
0:53.431 spenders Z unstable_affliction Fluffy_Pillow 89512.0/100000: 90% mana | 2.0/5: 40% soul_shard masterful_navigation(4), archive_of_the_titans(11)
0:54.727 fillers S unstable_affliction Fluffy_Pillow 90808.0/100000: 91% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(11)
0:56.023 fillers V drain_soul Fluffy_Pillow 92104.0/100000: 92% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation_final, archive_of_the_titans(12)
0:57.997 dots P agony Fluffy_Pillow 92078.0/100000: 92% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation_final, archive_of_the_titans(12)
0:59.295 fillers V drain_soul Fluffy_Pillow 92376.0/100000: 92% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation_final, archive_of_the_titans(12)
1:03.123 dots R corruption Fluffy_Pillow 92204.0/100000: 92% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(13)
1:04.420 default C haunt Fluffy_Pillow 92501.0/100000: 93% mana | 2.0/5: 40% soul_shard archive_of_the_titans(13)
1:05.836 dots Q siphon_life Fluffy_Pillow 91917.0/100000: 92% mana | 2.0/5: 40% soul_shard archive_of_the_titans(14)
1:07.132 spenders Z unstable_affliction Fluffy_Pillow 93213.0/100000: 93% mana | 2.0/5: 40% soul_shard masterful_navigation, archive_of_the_titans(14)
1:08.431 fillers V drain_soul Fluffy_Pillow 94512.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, archive_of_the_titans(14)
1:10.392 fillers S unstable_affliction Fluffy_Pillow 94473.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_crit, archive_of_the_titans(15)
1:11.688 fillers V drain_soul Fluffy_Pillow 95769.0/100000: 96% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation, elemental_whirl_crit, archive_of_the_titans(15)
1:15.392 dots P agony Fluffy_Pillow 95473.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation, elemental_whirl_crit, archive_of_the_titans(16)
1:16.690 dots R corruption Fluffy_Pillow 95771.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_crit, archive_of_the_titans(16)
1:17.986 fillers V drain_soul Fluffy_Pillow 96067.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_crit, archive_of_the_titans(16)
1:19.918 dots Q siphon_life Fluffy_Pillow 95999.0/100000: 96% mana | 1.0/5: 20% soul_shard masterful_navigation, archive_of_the_titans(16)
1:21.215 default C haunt Fluffy_Pillow 97296.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation, archive_of_the_titans(17)
1:22.512 spenders Z unstable_affliction Fluffy_Pillow 96593.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation, archive_of_the_titans(17)
1:23.809 fillers V drain_soul Fluffy_Pillow 97890.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, archive_of_the_titans(17)
1:25.841 fillers S unstable_affliction Fluffy_Pillow 97922.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, archive_of_the_titans(18)
1:27.137 fillers V drain_soul Fluffy_Pillow 99218.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation, archive_of_the_titans(18)
1:30.940 dots R corruption Fluffy_Pillow 98942.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(25), archive_of_the_titans(19)
1:32.140 fillers V drain_soul Fluffy_Pillow 99142.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), overwhelming_power(23), archive_of_the_titans(19)
1:33.992 dots P agony Fluffy_Pillow 98994.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), overwhelming_power(22), archive_of_the_titans(19)
1:35.204 default G phantom_singularity Fluffy_Pillow 99206.0/100000: 99% mana | 1.0/5: 20% soul_shard masterful_navigation(3), overwhelming_power(20), archive_of_the_titans(20)
1:36.421 dots Q siphon_life Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard masterful_navigation(3), overwhelming_power(19), archive_of_the_titans(20)
1:37.642 default C haunt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard masterful_navigation(3), overwhelming_power(18), archive_of_the_titans(20)
1:38.867 cooldowns O use_items Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation_final, elemental_whirl_versatility, overwhelming_power(17), archive_of_the_titans(20)
1:38.867 spenders Z unstable_affliction Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation_final, elemental_whirl_versatility, overwhelming_power(17), archive_of_the_titans(20), kindled_soul(100)
1:40.096 fillers V drain_soul Fluffy_Pillow 99232.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, elemental_whirl_versatility, overwhelming_power(15), archive_of_the_titans(20), kindled_soul(95)
1:42.095 fillers S unstable_affliction Fluffy_Pillow 99177.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, elemental_whirl_versatility, overwhelming_power(13), archive_of_the_titans(20), kindled_soul(85)
1:43.339 fillers V drain_soul Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation_final, elemental_whirl_versatility, overwhelming_power(12), archive_of_the_titans(20), kindled_soul(80)
1:45.285 dots R corruption Fluffy_Pillow 99117.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation_final, elemental_whirl_versatility, overwhelming_power(10), archive_of_the_titans(20), kindled_soul(70)
1:46.543 fillers V drain_soul Fluffy_Pillow 99375.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation_final, elemental_whirl_versatility, overwhelming_power(9), archive_of_the_titans(20), kindled_soul(65)
1:50.053 dots Q siphon_life Fluffy_Pillow 98673.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(5), archive_of_the_titans(20), kindled_soul(45)
1:51.332 dots P agony Fluffy_Pillow 99952.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(4), archive_of_the_titans(20), kindled_soul(40)
1:52.613 spenders Z unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard overwhelming_power(3), archive_of_the_titans(20), kindled_soul(35)
1:53.897 default C haunt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, overwhelming_power(2), archive_of_the_titans(20), kindled_soul(25)
1:55.184 fillers V drain_soul Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, archive_of_the_titans(20), kindled_soul(20)
1:58.841 dots R corruption Fluffy_Pillow 97660.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, archive_of_the_titans(20), kindled_soul(5)
2:00.137 fillers V drain_soul Fluffy_Pillow 97956.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, archive_of_the_titans(20)
2:02.066 spenders Z unstable_affliction Fluffy_Pillow 97885.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(2), archive_of_the_titans(20)
2:03.362 fillers V drain_soul Fluffy_Pillow 99181.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20)
2:05.312 dots Q siphon_life Fluffy_Pillow 99089.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20)
2:06.608 fillers V drain_soul Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20)
2:09.442 dots P agony Fluffy_Pillow 98973.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20)
2:10.739 default C haunt Fluffy_Pillow 99270.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20)
2:12.036 fillers V drain_soul Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard masterful_navigation(2), archive_of_the_titans(20)
2:13.930 dots R corruption Fluffy_Pillow 97899.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(2), archive_of_the_titans(20)
2:15.227 spenders Z unstable_affliction Fluffy_Pillow 98196.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(2), archive_of_the_titans(20)
2:16.524 fillers V drain_soul Fluffy_Pillow 99493.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20)
2:18.435 fillers S unstable_affliction Fluffy_Pillow 99050.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20)
2:19.730 fillers V drain_soul Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(2), archive_of_the_titans(20)
2:21.696 default G phantom_singularity Fluffy_Pillow 99105.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(2), archive_of_the_titans(20)
2:22.992 dots Q siphon_life Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(2), archive_of_the_titans(20)
2:24.290 fillers V drain_soul Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(3), archive_of_the_titans(20)
2:27.100 default C haunt Fluffy_Pillow 98949.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
2:28.398 dots P agony Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
2:29.696 dots R corruption Fluffy_Pillow 98304.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
2:30.993 fillers V drain_soul Fluffy_Pillow 98601.0/100000: 99% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
2:32.945 fillers V drain_soul Fluffy_Pillow 98553.0/100000: 99% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
2:34.868 dots Q siphon_life Fluffy_Pillow 98476.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
2:36.163 fillers S unstable_affliction Fluffy_Pillow 99771.0/100000: 100% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
2:37.460 fillers V drain_soul Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
2:41.172 dots R corruption Fluffy_Pillow 98851.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
2:42.468 fillers V drain_soul Fluffy_Pillow 99147.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
2:44.446 default C haunt Fluffy_Pillow 99117.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), elemental_whirl_haste, archive_of_the_titans(20)
2:45.702 dots P agony Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(3), elemental_whirl_haste, archive_of_the_titans(20)
2:46.958 fillers V drain_soul Fluffy_Pillow 98262.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(3), elemental_whirl_haste, archive_of_the_titans(20)
2:48.967 fillers V drain_soul Fluffy_Pillow 98271.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(4), elemental_whirl_haste, archive_of_the_titans(20)
2:50.890 dots Q siphon_life Fluffy_Pillow 98194.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation_final, elemental_whirl_haste, archive_of_the_titans(20)
2:52.145 fillers V drain_soul Fluffy_Pillow 99449.0/100000: 99% mana | 1.0/5: 20% soul_shard masterful_navigation_final, elemental_whirl_haste, archive_of_the_titans(20)
2:54.110 dots R corruption Fluffy_Pillow 99132.0/100000: 99% mana | 2.0/5: 40% soul_shard masterful_navigation_final, elemental_whirl_haste, archive_of_the_titans(20)
2:55.366 fillers V drain_soul Fluffy_Pillow 99388.0/100000: 99% mana | 2.0/5: 40% soul_shard masterful_navigation_final, archive_of_the_titans(20)
2:57.322 fillers V drain_soul Fluffy_Pillow 99095.0/100000: 99% mana | 3.0/5: 60% soul_shard masterful_navigation_final, archive_of_the_titans(20)
2:59.338 fillers V drain_soul Fluffy_Pillow 99111.0/100000: 99% mana | 3.0/5: 60% soul_shard archive_of_the_titans(20)
3:01.202 default C haunt Fluffy_Pillow 98975.0/100000: 99% mana | 3.0/5: 60% soul_shard archive_of_the_titans(20)
3:02.499 fillers V drain_soul Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard elemental_whirl_mastery, archive_of_the_titans(20)
3:04.373 fillers V drain_soul Fluffy_Pillow 97879.0/100000: 98% mana | 3.0/5: 60% soul_shard elemental_whirl_mastery, overwhelming_power(24), archive_of_the_titans(20)
3:06.261 default E agony Fluffy_Pillow 97767.0/100000: 98% mana | 4.0/5: 80% soul_shard elemental_whirl_mastery, overwhelming_power(22), archive_of_the_titans(20)
3:07.473 default G phantom_singularity Fluffy_Pillow 97979.0/100000: 98% mana | 4.0/5: 80% soul_shard elemental_whirl_mastery, overwhelming_power(21), archive_of_the_titans(20)
3:08.689 default K dark_soul Fluffy_Pillow 99195.0/100000: 99% mana | 4.0/5: 80% soul_shard elemental_whirl_mastery, overwhelming_power(20), archive_of_the_titans(20)
3:09.906 cooldowns N potion Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard dark_soul, elemental_whirl_mastery, overwhelming_power(19), archive_of_the_titans(20)
3:09.906 dots Q siphon_life Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard dark_soul, elemental_whirl_mastery, overwhelming_power(19), archive_of_the_titans(20), battle_potion_of_intellect
3:10.886 spenders W unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard dark_soul, masterful_navigation, elemental_whirl_mastery, overwhelming_power(18), archive_of_the_titans(20), battle_potion_of_intellect
3:11.867 dots R corruption Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard active_uas, dark_soul, masterful_navigation, elemental_whirl_mastery, overwhelming_power(17), archive_of_the_titans(20), battle_potion_of_intellect
3:12.851 spenders W unstable_affliction Fluffy_Pillow 99984.0/100000: 100% mana | 4.0/5: 80% soul_shard active_uas, dark_soul, masterful_navigation, overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
3:13.837 spenders W unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard active_uas(2), dark_soul, masterful_navigation, overwhelming_power(15), archive_of_the_titans(20), battle_potion_of_intellect
3:14.824 spenders W unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard active_uas(3), dark_soul, masterful_navigation, overwhelming_power(14), archive_of_the_titans(20), battle_potion_of_intellect
3:15.817 spenders W unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard active_uas(4), dark_soul, masterful_navigation, overwhelming_power(13), archive_of_the_titans(20), battle_potion_of_intellect
3:16.815 cooldowns O use_items Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation, overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect
3:16.815 default D summon_darkglare Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation, overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(100)
3:17.816 default C haunt Fluffy_Pillow 99001.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation, overwhelming_power(11), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(95)
3:18.816 fillers V drain_soul Fluffy_Pillow 98001.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation, overwhelming_power(10), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(90)
3:21.070 fillers S unstable_affliction Fluffy_Pillow 97255.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas(5), dark_soul, masterful_navigation(2), overwhelming_power(7), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(80)
3:22.084 fillers V drain_soul Fluffy_Pillow 98269.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation(2), overwhelming_power(6), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(75)
3:29.778 dots P agony Fluffy_Pillow 94963.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas(5), masterful_navigation_final, overwhelming_power(22), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(40)
3:30.990 dots Q siphon_life Fluffy_Pillow 95175.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas(3), masterful_navigation_final, overwhelming_power(21), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(30)
3:32.205 dots R corruption Fluffy_Pillow 96390.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation_final, overwhelming_power(19), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(25)
3:33.427 spenders Z unstable_affliction Fluffy_Pillow 96612.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation_final, overwhelming_power(18), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(20)
3:34.652 default C haunt Fluffy_Pillow 97837.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, overwhelming_power(17), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(15)
3:35.883 fillers V drain_soul Fluffy_Pillow 97068.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, overwhelming_power(16), archive_of_the_titans(20), kindled_soul(5)
3:37.752 fillers S unstable_affliction Fluffy_Pillow 96937.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, overwhelming_power(14), archive_of_the_titans(20)
3:38.994 fillers V drain_soul Fluffy_Pillow 98179.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(13), archive_of_the_titans(20)
3:44.242 dots Q siphon_life Fluffy_Pillow 97427.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), overwhelming_power(7), archive_of_the_titans(20)
3:45.510 dots R corruption Fluffy_Pillow 98695.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), overwhelming_power(6), archive_of_the_titans(20)
3:46.782 dots P agony Fluffy_Pillow 98967.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), overwhelming_power(5), archive_of_the_titans(20)
3:48.058 spenders Z unstable_affliction Fluffy_Pillow 99243.0/100000: 99% mana | 1.0/5: 20% soul_shard masterful_navigation(4), overwhelming_power(3), archive_of_the_titans(20)
3:49.342 fillers V drain_soul Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
3:51.140 default C haunt Fluffy_Pillow 99001.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
3:52.349 default G phantom_singularity Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
3:53.683 fillers V drain_soul Fluffy_Pillow 99340.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
3:55.612 fillers S unstable_affliction Fluffy_Pillow 99122.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
3:56.837 fillers V drain_soul Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
3:58.743 dots Q siphon_life Fluffy_Pillow 99092.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
3:59.947 dots R corruption Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
4:01.156 fillers V drain_soul Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(21), archive_of_the_titans(20)
4:04.680 dots P agony Fluffy_Pillow 98717.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, elemental_whirl_crit, overwhelming_power(18), archive_of_the_titans(20)
4:05.905 spenders Z unstable_affliction Fluffy_Pillow 98942.0/100000: 99% mana | 1.0/5: 20% soul_shard elemental_whirl_crit, overwhelming_power(17), archive_of_the_titans(20)
4:07.135 default C haunt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, elemental_whirl_crit, overwhelming_power(15), archive_of_the_titans(20)
4:08.580 fillers V drain_soul Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, elemental_whirl_crit, elemental_whirl_haste, overwhelming_power(14), archive_of_the_titans(20)
4:11.279 fillers S unstable_affliction Fluffy_Pillow 97703.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_haste, overwhelming_power(11), archive_of_the_titans(20)
4:12.493 dots R corruption Fluffy_Pillow 98917.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation, elemental_whirl_haste, overwhelming_power(10), archive_of_the_titans(20)
4:13.710 dots Q siphon_life Fluffy_Pillow 99134.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation, elemental_whirl_haste, overwhelming_power(9), archive_of_the_titans(20)
4:14.931 fillers V drain_soul Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(2), elemental_whirl_haste, overwhelming_power(8), archive_of_the_titans(20)
4:20.113 spenders Z unstable_affliction Fluffy_Pillow 98369.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), overwhelming_power(2), archive_of_the_titans(20)
4:21.402 fillers V drain_soul Fluffy_Pillow 99658.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, overwhelming_power, archive_of_the_titans(20)
4:23.400 default C haunt Fluffy_Pillow 99140.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:24.872 dots P agony Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:26.168 dots R corruption Fluffy_Pillow 98300.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:27.467 fillers S unstable_affliction Fluffy_Pillow 98599.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:28.764 dots Q siphon_life Fluffy_Pillow 99896.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation_final, archive_of_the_titans(20)
4:30.061 fillers V drain_soul Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:36.287 spenders Z unstable_affliction Fluffy_Pillow 98365.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, overwhelming_power(19), archive_of_the_titans(20)
4:37.509 default G phantom_singularity Fluffy_Pillow 99587.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, overwhelming_power(18), archive_of_the_titans(20)
4:38.737 fillers V drain_soul Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, overwhelming_power(17), archive_of_the_titans(20)
4:40.649 default C haunt Fluffy_Pillow 99095.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, overwhelming_power(15), archive_of_the_titans(20)
4:41.888 dots P agony Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, overwhelming_power(14), archive_of_the_titans(20)
4:43.129 dots R corruption Fluffy_Pillow 98247.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, overwhelming_power(12), archive_of_the_titans(20)
4:44.378 dots Q siphon_life Fluffy_Pillow 98496.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(11), archive_of_the_titans(20)
4:45.632 spenders Z unstable_affliction Fluffy_Pillow 99750.0/100000: 100% mana | 1.0/5: 20% soul_shard masterful_navigation(2), overwhelming_power(10), archive_of_the_titans(20)
4:46.890 cooldowns O use_items Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), overwhelming_power(9), archive_of_the_titans(20)
4:46.890 fillers V drain_soul Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), overwhelming_power(9), archive_of_the_titans(20), kindled_soul(100)
4:52.081 spenders Y unstable_affliction Fluffy_Pillow 98354.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), overwhelming_power(22), archive_of_the_titans(20), kindled_soul(75)
4:53.292 fillers V drain_soul Fluffy_Pillow 99565.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(3), overwhelming_power(21), archive_of_the_titans(20), kindled_soul(70)
4:58.394 default C haunt Fluffy_Pillow 98295.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), overwhelming_power(16), archive_of_the_titans(20), kindled_soul(45)
4:59.628 default B drain_soul Fluffy_Pillow 97529.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), overwhelming_power(15), archive_of_the_titans(20), kindled_soul(40)

Stats

Level Bonus (120) Race Bonus (goblin) Raid-Buffed Unbuffed Gear Amount
Strength 1467 -3 1524 1464 0
Agility 1467 1 1528 1468 0
Stamina 1001 -1 9025 8205 7205
Intellect 1467 3 8169 7008 5205 (377)
Spirit 0 0 0 0 0
Health 180500 164100 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8169 7008 0
Crit 16.14% 16.14% 802
Haste 16.06% 16.06% 1014
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 62.35% 62.35% 1220
Armor 1165 1165 1165
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Visage of the Ascended Prophet
ilevel: 390, stats: { 155 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Mantle of Contained Corruption
ilevel: 390, stats: { 143 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 190 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 161 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 115 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Ring of the Infinite Void
ilevel: 385, stats: { +312 Sta, +240 Mastery, +191 Crit }, enchant: { +37 Mastery }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Mastery }
Local Trinket1 Balefire Branch
ilevel: 370, stats: { +164 Mastery }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 92 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: masterful_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Nightfall (Affliction Warlock) Drain Soul (Affliction Warlock) Deathbolt (Affliction Warlock)
30 Writhe in Agony (Affliction Warlock) Absolute Corruption (Affliction Warlock) Siphon Life (Affliction Warlock)
45 Demon Skin Burning Rush Dark Pact
60 Sow the Seeds (Affliction Warlock) Phantom Singularity Vile Taint (Affliction Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Shadow Embrace (Affliction Warlock) Haunt (Affliction Warlock) Grimoire of Sacrifice
100 Soul Conduit Creeping Death (Affliction Warlock) Dark Soul: Misery (Affliction Warlock)

Profile

warlock="Drain_Soul"
source=default
spec=affliction
level=120
race=goblin
role=spell
position=ranged_back
talents=2302023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/seed_of_corruption,if=spell_targets.seed_of_corruption_aoe>=3
actions.precombat+=/haunt
actions.precombat+=/shadow_bolt,if=!talent.haunt.enabled&spell_targets.seed_of_corruption_aoe<3

# Executed every time the actor is available.
actions=variable,name=use_seed,value=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up|talent.siphon_life.enabled&spell_targets.seed_of_corruption>=5+raid_event.invulnerable.up|spell_targets.seed_of_corruption>=8+raid_event.invulnerable.up
actions+=/variable,name=padding,op=set,value=action.shadow_bolt.execute_time*azerite.cascading_calamity.enabled
actions+=/variable,name=padding,op=reset,value=gcd,if=azerite.cascading_calamity.enabled&(talent.drain_soul.enabled|talent.deathbolt.enabled&cooldown.deathbolt.remains<=gcd)
actions+=/variable,name=maintain_se,value=spell_targets.seed_of_corruption_aoe<=1+talent.writhe_in_agony.enabled+talent.absolute_corruption.enabled*2+(talent.writhe_in_agony.enabled&talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>2)+(talent.siphon_life.enabled&!talent.creeping_death.enabled&!talent.drain_soul.enabled)+raid_event.invulnerable.up
actions+=/call_action_list,name=cooldowns
actions+=/drain_soul,interrupt_global=1,chain=1,cycle_targets=1,if=target.time_to_die<=gcd&soul_shard<5
actions+=/haunt,if=spell_targets.seed_of_corruption_aoe<=2+raid_event.invulnerable.up
actions+=/summon_darkglare,if=dot.agony.ticking&dot.corruption.ticking&(buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up)
actions+=/deathbolt,if=cooldown.summon_darkglare.remains&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up
actions+=/agony,target_if=min:dot.agony.remains,if=remains<=gcd+action.shadow_bolt.execute_time&target.time_to_die>8
actions+=/unstable_affliction,target_if=!contagion&target.time_to_die<=8
actions+=/drain_soul,target_if=min:debuff.shadow_embrace.remains,cancel_if=ticks_remain<5,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=gcd*2
actions+=/shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=execute_time*2+travel_time&!action.shadow_bolt.in_flight
actions+=/phantom_singularity,target_if=max:target.time_to_die,if=time>35&(cooldown.summon_darkglare.remains>=45|cooldown.summon_darkglare.remains<8)&target.time_to_die>16*spell_haste
actions+=/vile_taint,target_if=max:target.time_to_die,if=time>15&target.time_to_die>=10
actions+=/unstable_affliction,target_if=min:contagion,if=!variable.use_seed&soul_shard=5
actions+=/seed_of_corruption,if=variable.use_seed&soul_shard=5
actions+=/call_action_list,name=dots
actions+=/phantom_singularity,if=time<=35
actions+=/vile_taint,if=time<15
actions+=/dark_soul,if=cooldown.summon_darkglare.remains<10&dot.phantom_singularity.remains|target.time_to_die<20+gcd|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up
actions+=/berserking
actions+=/call_action_list,name=spenders
actions+=/call_action_list,name=fillers

actions.cooldowns=potion,if=(talent.dark_soul_misery.enabled&cooldown.summon_darkglare.up&cooldown.dark_soul.up)|cooldown.summon_darkglare.up|target.time_to_die<30
actions.cooldowns+=/use_items,if=!cooldown.summon_darkglare.up,if=cooldown.summon_darkglare.remains>70|time_to_die<20|((buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains)&!cooldown.summon_darkglare.remains)
actions.cooldowns+=/fireblood,if=!cooldown.summon_darkglare.up
actions.cooldowns+=/blood_fury,if=!cooldown.summon_darkglare.up

actions.db_refresh=siphon_life,line_cd=15,if=(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.corruption.remains%dot.corruption.duration)&dot.siphon_life.remains<dot.siphon_life.duration*1.3
actions.db_refresh+=/agony,line_cd=15,if=(dot.agony.remains%dot.agony.duration)<=(dot.corruption.remains%dot.corruption.duration)&(dot.agony.remains%dot.agony.duration)<=(dot.siphon_life.remains%dot.siphon_life.duration)&dot.agony.remains<dot.agony.duration*1.3
actions.db_refresh+=/corruption,line_cd=15,if=(dot.corruption.remains%dot.corruption.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.corruption.remains%dot.corruption.duration)<=(dot.siphon_life.remains%dot.siphon_life.duration)&dot.corruption.remains<dot.corruption.duration*1.3

actions.dots=seed_of_corruption,if=dot.corruption.remains<=action.seed_of_corruption.cast_time+time_to_shard+4.2*(1-talent.creeping_death.enabled*0.15)&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&!dot.seed_of_corruption.remains&!action.seed_of_corruption.in_flight
actions.dots+=/agony,target_if=min:remains,if=talent.creeping_death.enabled&active_dot.agony<6&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
actions.dots+=/agony,target_if=min:remains,if=!talent.creeping_death.enabled&active_dot.agony<8&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
actions.dots+=/siphon_life,target_if=min:remains,if=(active_dot.siphon_life<8-talent.creeping_death.enabled-spell_targets.sow_the_seeds_aoe)&target.time_to_die>10&refreshable&(!remains&spell_targets.seed_of_corruption_aoe=1|cooldown.summon_darkglare.remains>soul_shard*action.unstable_affliction.execute_time)
actions.dots+=/corruption,cycle_targets=1,if=spell_targets.seed_of_corruption_aoe<3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)&target.time_to_die>10

actions.fillers=unstable_affliction,line_cd=15,if=cooldown.deathbolt.remains<=gcd*2&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains>20
actions.fillers+=/call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&(dot.agony.remains<dot.agony.duration*0.75|dot.corruption.remains<dot.corruption.duration*0.75|dot.siphon_life.remains<dot.siphon_life.duration*0.75)&cooldown.deathbolt.remains<=action.agony.gcd*4&cooldown.summon_darkglare.remains>20
actions.fillers+=/call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains<=soul_shard*action.agony.gcd+action.agony.gcd*3&(dot.agony.remains<dot.agony.duration*1|dot.corruption.remains<dot.corruption.duration*1|dot.siphon_life.remains<dot.siphon_life.duration*1)
actions.fillers+=/deathbolt,if=cooldown.summon_darkglare.remains>=30+gcd|cooldown.summon_darkglare.remains>140
actions.fillers+=/shadow_bolt,if=buff.movement.up&buff.nightfall.remains
actions.fillers+=/agony,if=buff.movement.up&!(talent.siphon_life.enabled&(prev_gcd.1.agony&prev_gcd.2.agony&prev_gcd.3.agony)|prev_gcd.1.agony)
actions.fillers+=/siphon_life,if=buff.movement.up&!(prev_gcd.1.siphon_life&prev_gcd.2.siphon_life&prev_gcd.3.siphon_life)
actions.fillers+=/corruption,if=buff.movement.up&!prev_gcd.1.corruption&!talent.absolute_corruption.enabled
actions.fillers+=/drain_life,if=(buff.inevitable_demise.stack>=85-(spell_targets.seed_of_corruption_aoe-raid_event.invulnerable.up>2)*20&(cooldown.deathbolt.remains>execute_time|!talent.deathbolt.enabled)&(cooldown.phantom_singularity.remains>execute_time|!talent.phantom_singularity.enabled)&(cooldown.dark_soul.remains>execute_time|!talent.dark_soul_misery.enabled)&(cooldown.vile_taint.remains>execute_time|!talent.vile_taint.enabled)&cooldown.summon_darkglare.remains>execute_time+10|buff.inevitable_demise.stack>30&target.time_to_die<=10)
actions.fillers+=/haunt
actions.fillers+=/drain_soul,interrupt_global=1,chain=1,interrupt=1,cycle_targets=1,if=target.time_to_die<=gcd
actions.fillers+=/drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains
actions.fillers+=/drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se
actions.fillers+=/drain_soul,interrupt_global=1,chain=1,interrupt=1
actions.fillers+=/shadow_bolt,cycle_targets=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains&!action.shadow_bolt.in_flight
actions.fillers+=/shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se
actions.fillers+=/shadow_bolt

actions.spenders=unstable_affliction,if=cooldown.summon_darkglare.remains<=soul_shard*execute_time&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=soul_shard*execute_time)
actions.spenders+=/call_action_list,name=fillers,if=(cooldown.summon_darkglare.remains<time_to_shard*(6-soul_shard)|cooldown.summon_darkglare.up)&time_to_die>cooldown.summon_darkglare.remains
actions.spenders+=/seed_of_corruption,if=variable.use_seed
actions.spenders+=/unstable_affliction,if=!variable.use_seed&!prev_gcd.1.summon_darkglare&(talent.deathbolt.enabled&cooldown.deathbolt.remains<=execute_time&!azerite.cascading_calamity.enabled|(soul_shard>=5&spell_targets.seed_of_corruption_aoe<2|soul_shard>=2&spell_targets.seed_of_corruption_aoe>=2)&target.time_to_die>4+execute_time&spell_targets.seed_of_corruption_aoe=1|target.time_to_die<=8+execute_time*soul_shard)
actions.spenders+=/unstable_affliction,if=!variable.use_seed&contagion<=cast_time+variable.padding
actions.spenders+=/unstable_affliction,cycle_targets=1,if=!variable.use_seed&(!talent.deathbolt.enabled|cooldown.deathbolt.remains>time_to_shard|soul_shard>1)&(!talent.vile_taint.enabled|soul_shard>1)&contagion<=cast_time+variable.padding&(!azerite.cascading_calamity.enabled|buff.cascading_calamity.remains>time_to_shard)

head=visage_of_the_ascended_prophet,id=160719,bonus_id=4824/1507/4775,azerite_powers=483/21/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=mantle_of_contained_corruption,id=160613,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=ring_of_the_infinite_void,id=160647,bonus_id=4800/1507,enchant=pact_of_mastery
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_mastery
trinket1=balefire_branch,id=159630,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=masterful_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5205
# gear_crit_rating=802
# gear_haste_rating=1014
# gear_mastery_rating=1220
# gear_versatility_rating=129
# gear_armor=1165
default_pet=succubus

Nightfall : 16763 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16763.0 16763.0 5.1 / 0.030% 1591.5 / 9.5% 14.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
945.4 933.9 Mana 0.00% 46.1 100.0% 100%
Talents
  • 15: Nightfall (Affliction Warlock)
  • 30: Siphon Life (Affliction Warlock)
  • 60: Phantom Singularity
  • 90: Haunt (Affliction Warlock)
  • 100: Dark Soul: Misery (Affliction Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Nightfall 16763
Agony 1469 8.8% 16.0 18.61sec 27575 22639 Periodic 192.2 1970 3941 2294 16.4% 99.6%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.98 0.00 192.16 192.16 1.2181 1.5544 440735.74 440735.74 0.00 1385.20 22638.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 160.6 83.59% 1970.26 1 3075 1969.82 1909 2028 316501 316501 0.00
crit 31.5 16.41% 3940.82 2 6150 3940.15 3347 4339 124235 124235 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=gcd+action.shadow_bolt.execute_time&target.time_to_die>8
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.008000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Corruption 1666 10.0% 20.1 14.69sec 24854 20683 Periodic 190.3 2254 4508 2625 16.5% 98.2%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.10 0.00 190.31 190.31 1.2017 1.5475 499539.01 499539.01 0.00 1567.63 20683.13
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 159.0 83.54% 2253.89 1 3459 2253.91 2182 2321 358323 358323 0.00
crit 31.3 16.46% 4507.70 3 6919 4507.86 4127 4954 141216 141216 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.090000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Haunt 529 3.2% 17.4 16.78sec 9094 7553 Direct 18.4 7408 14825 8628 16.5%  

Stats details: haunt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.43 18.37 0.00 0.00 1.2040 0.0000 158534.55 158534.55 0.00 7553.22 7553.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.35 83.54% 7407.57 6235 10991 7408.74 6855 7896 113703 113703 0.00
crit 3.02 16.46% 14825.41 12470 21812 14238.84 0 21644 44832 44832 0.00
 
 

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:48181
  • name:Haunt
  • school:shadow
  • tooltip:Taking {$s2=10}% increased damage from the Warlock. Haunt's cooldown will be reset on death.
  • description:A ghostly soul haunts the target, dealing {$s1=0} Shadow damage and increasing your damage dealt to the target by {$s2=10}% for {$d=15 seconds}. If the target dies, Haunt's cooldown is reset.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25
 
Heed My Call 158 (226) 0.9% (1.4%) 7.0 38.42sec 9656 0 Direct 7.0 5800 11604 6758 16.5%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.0000 0.0000 47536.88 47536.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.87 83.50% 5800.20 4925 6141 5795.85 0 6141 34071 34071 0.00
crit 1.16 16.50% 11603.85 9849 12282 8036.51 0 12282 13466 13466 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 68 0.4% 7.0 38.42sec 2898 0 Direct 7.0 2486 4972 2898 16.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.0000 0.0000 20388.23 20388.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.87 83.41% 2485.87 2111 2632 2484.54 0 2632 14587 14587 0.00
crit 1.17 16.59% 4972.31 4221 5264 3459.04 0 5264 5802 5802 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
  • base_dd_mult:1.00
 
Phantom Singularity 1103 6.6% 6.7 45.79sec 48984 39966 Periodic 70.1 4705 0 4705 0.0% 34.6%

Stats details: phantom_singularity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 0.00 70.12 70.12 1.2257 1.4795 329916.58 329916.58 0.00 2945.84 39965.67
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.1 100.00% 4705.04 4 6919 4706.36 4469 5010 329917 329917 0.00
 
 

Action details: phantom_singularity

Static Values
  • id:205179
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time>35&(cooldown.summon_darkglare.remains>=45|cooldown.summon_darkglare.remains<8)&target.time_to_die>16*spell_haste
Spelldata
  • id:205179
  • name:Phantom Singularity
  • school:shadow
  • tooltip:Dealing damage to all nearby targets every $t1 sec and healing the casting Warlock.
  • description:Places a phantom singularity above the target, which consumes the life of all enemies within $205246A2 yards, dealing ${8*{$205246s2=0 + 18.0%}} damage over {$d=16 seconds}, healing you for ${$205246e2*100}% of the damage done.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 

Action details: phantom_singularity_tick

Static Values
  • id:205246
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205246
  • name:Phantom Singularity
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205179=Places a phantom singularity above the target, which consumes the life of all enemies within $205246A2 yards, dealing ${8*{$205246s2=0 + 18.0%}} damage over {$d=16 seconds}, healing you for ${$205246e2*100}% of the damage done.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.180000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25
 
Shadow Bolt 3252 19.4% 103.3 2.82sec 9436 6274 Direct 102.5 8168 16337 9512 16.5%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.34 102.52 0.00 0.00 1.5040 0.0000 975130.96 975130.96 0.00 6274.25 6274.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.65 83.54% 8167.57 5189 16187 8166.50 7311 9164 699522 699522 0.00
crit 16.87 16.46% 16337.50 10378 32373 16335.37 12625 27147 275609 275609 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:232670
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.haunt.enabled&spell_targets.seed_of_corruption_aoe<3
Spelldata
  • id:232670
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25
 
Siphon Life 1483 8.9% 18.9 15.73sec 23562 19695 Periodic 127.6 2993 5986 3486 16.4% 98.6%

Stats details: siphon_life

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.88 0.00 127.64 127.64 1.1964 2.3180 444887.12 444887.12 0.00 1397.03 19694.86
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.6 83.55% 2993.14 1 4613 2992.95 2889 3084 319198 319198 0.00
crit 21.0 16.45% 5986.47 2 9225 5986.14 5166 6619 125689 125689 0.00
 
 

Action details: siphon_life

Static Values
  • id:63106
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.corruption.remains%dot.corruption.duration)&dot.siphon_life.remains<dot.siphon_life.duration*1.3
Spelldata
  • id:63106
  • name:Siphon Life
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and siphoning life to the casting Warlock.
  • description:Siphons the target's life essence, dealing $o1 Shadow damage over {$d=15 seconds} and healing you for ${$e1*100}% of the damage done.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.120000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Unstable Affliction 0 (3635) 0.0% (21.7%) 38.2 7.79sec 28483 25037

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.16 0.00 0.00 0.00 1.1377 0.0000 0.00 0.00 0.00 25036.83 25036.83
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
 
    Unstable Affliction (_1) 1705 10.2% 0.0 0.00sec 0 0 Periodic 106.9 4110 8218 4785 16.4% 57.7%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 106.94 106.94 0.0000 1.6181 511681.10 511681.10 0.00 2956.99 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.4 83.57% 4109.61 2 6150 4110.07 3970 4268 367302 367302 0.00
crit 17.6 16.43% 8218.39 4 12300 8219.53 6744 9309 144379 144379 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 1096 6.5% 0.0 0.00sec 0 0 Periodic 67.8 4155 8310 4838 16.4% 37.1%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 67.85 67.85 0.0000 1.6403 328260.38 328260.38 0.00 2949.59 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.7 83.56% 4155.41 7 6150 4158.37 3932 4472 235587 235587 0.00
crit 11.2 16.44% 8309.51 5 12300 8314.92 6881 10210 92673 92673 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 329 1.9% 0.0 0.00sec 0 0 Periodic 18.0 4637 9275 5397 16.4% 10.7%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 18.05 18.05 0.0000 1.7745 97400.11 97400.11 0.00 3041.66 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.1 83.60% 4636.58 26 6150 4636.97 4289 5064 69954 69954 0.00
crit 3.0 16.40% 9275.02 3513 12300 8903.11 0 12023 27446 27446 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 308 1.8% 0.0 0.00sec 0 0 Periodic 16.9 4621 9242 5384 16.5% 10.0%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 16.91 16.91 0.0000 1.7651 91072.41 91072.41 0.00 3050.39 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.1 83.49% 4621.24 3716 6150 4619.08 4120 5105 65260 65260 0.00
crit 2.8 16.51% 9241.82 7432 12300 8767.31 0 11935 25812 25812 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 197 1.2% 0.0 0.00sec 0 0 Periodic 10.7 4671 9340 5443 16.5% 6.0%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 10.73 10.73 0.0000 1.6755 58409.81 58409.81 0.00 3248.60 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.0 83.47% 4671.16 3552 6103 4581.98 0 5691 41841 41841 0.00
crit 1.8 16.53% 9340.13 7319 12016 7602.23 0 11843 16569 16569 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Volatile Blood Explosion 326 1.9% 7.1 37.91sec 13847 0 Direct 7.0 12060 24129 14037 16.4%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 6.97 0.00 0.00 0.0000 0.0000 97844.10 97844.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.83 83.62% 12060.33 10240 12770 12050.45 0 12770 70301 70301 0.00
crit 1.14 16.38% 24128.65 20481 25540 16654.40 0 25540 27543 27543 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies. Deals increased damage when striking multiple targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
  • base_dd_mult:1.00
 
pet - darkglare 5738 / 776
Eye Beam (dark_glare) 5738 4.6% 31.6 6.70sec 7263 5939 Direct 31.6 6236 12482 7263 16.4%  

Stats details: dark_glare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.60 31.60 0.00 0.00 1.2229 0.0000 229536.46 229536.46 0.00 5938.85 5938.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.41 83.56% 6236.15 3792 7971 6236.56 5780 6867 164696 164696 0.00
crit 5.19 16.44% 12482.07 7584 15942 12433.73 0 15572 64840 64840 0.00
 
 

Action details: dark_glare

Static Values
  • id:205231
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205231
  • name:Eye Beam
  • school:shadow
  • tooltip:
  • description:Fires an eye beam that deals {$s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.256000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
 
pet - succubus 2297 / 2297
Lash of Pain 1084 6.5% 64.5 4.74sec 5034 6108 Direct 64.5 4322 8645 5034 16.5%  

Stats details: lash_of_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.51 64.51 0.00 0.00 0.8242 0.0000 324734.29 324734.29 0.00 6107.82 6107.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.88 83.53% 4322.11 3889 5698 4322.09 4210 4413 232891 232891 0.00
crit 10.62 16.47% 8644.55 7778 11396 8644.10 8001 9885 91843 91843 0.00
 
 

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:7814
  • name:Lash of Pain
  • school:shadow
  • tooltip:
  • description:Lashes the target, dealing {$s1=0} Shadow damage. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
 
melee 1213 7.2% 123.8 2.43sec 2938 1218 Direct 123.8 2523 5045 2938 16.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.82 123.82 0.00 0.00 2.4127 0.0000 363810.88 520111.35 30.05 1217.80 1217.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 103.42 83.52% 2522.55 2267 3321 2522.57 2477 2562 260882 372962 30.05
crit 20.40 16.48% 5045.30 4534 6643 5045.40 4754 5574 102929 147150 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Nightfall
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nightfall
  • harmful:false
  • if_expr:
 
Dark Soul: Misery (dark_soul) 2.4 167.85sec

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.43 0.00 0.00 0.00 1.1549 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dark_soul

Static Values
  • id:113860
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_darkglare.remains<10&dot.phantom_singularity.remains|target.time_to_die<20+gcd|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up
Spelldata
  • id:113860
  • name:Dark Soul: Misery
  • school:shadow
  • tooltip:Haste increased by {$s1=30}%.
  • description:Infuses your soul with the misery of fallen foes, increasing haste by {$s1=30}% for {$d=20 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nightfall
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nightfall
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Darkglare 2.0 187.03sec

Stats details: summon_darkglare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8998 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_darkglare

Static Values
  • id:205180
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.agony.ticking&dot.corruption.ticking&(buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up)
Spelldata
  • id:205180
  • name:Summon Darkglare
  • school:shadow
  • tooltip:Summons a Darkglare from the Twisting Nether that blasts its target for Shadow damage, dealing increased damage for every damage over time effect you have active on any target.
  • description:Summons a Darkglare from the Twisting Nether that extends the duration of your damage over time effects on all enemies by {$s2=8} sec. The Darkglare will serve you for {$d=20 seconds}, blasting its target for {$205231s1=0} Shadow damage, increased by {$s3=10}% for every damage over time effect you have active on any target.
 
Summon Succubus 1.0 0.00sec

Stats details: summon_succubus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_succubus

Static Values
  • id:712
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:712
  • name:Summon Succubus
  • school:shadow
  • tooltip:
  • description:Summons a Succubus under your command to seduce enemy Humanoids, preventing them from attacking.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
active_uas 19.3 18.4 15.5sec 0.0sec 76.52% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • active_uas_1:55.09%
  • active_uas_2:11.04%
  • active_uas_3:1.69%
  • active_uas_4:3.53%
  • active_uas_5:5.17%
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:42.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dark Soul: Misery (dark_soul) 2.4 0.0 167.9sec 167.9sec 15.48% 0.00% 0.0(0.0) 2.1

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dark_soul_1:15.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:113860
  • name:Dark Soul: Misery
  • tooltip:Haste increased by {$s1=30}%.
  • description:Infuses your soul with the misery of fallen foes, increasing haste by {$s1=30}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.6 0.2 74.1sec 65.8sec 8.73% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_crit_1:8.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.5 0.2 73.6sec 65.2sec 8.70% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_haste_1:8.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.6 0.2 73.8sec 65.5sec 8.78% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_mastery_1:8.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 73.8sec 65.5sec 8.80% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_versatility_1:8.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 92.8sec 92.8sec 23.54% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Buff details

  • stat:intellect
  • amount:16.00

Stack Uptimes

  • kindled_soul_5:1.15%
  • kindled_soul_10:1.15%
  • kindled_soul_15:1.16%
  • kindled_soul_20:1.16%
  • kindled_soul_25:1.16%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.17%
  • kindled_soul_40:1.17%
  • kindled_soul_45:1.17%
  • kindled_soul_50:1.18%
  • kindled_soul_55:1.18%
  • kindled_soul_60:1.18%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.19%
  • kindled_soul_75:1.19%
  • kindled_soul_80:1.19%
  • kindled_soul_85:1.20%
  • kindled_soul_90:1.20%
  • kindled_soul_95:1.20%
  • kindled_soul_100:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by $w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining ${$268998U1*{$268998s1=9}} Intellect, which decays over $D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Masterful Navigation 6.0 22.5 52.0sec 10.3sec 66.80% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_masterful_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:50.00

Stack Uptimes

  • masterful_navigation_1:17.43%
  • masterful_navigation_2:16.94%
  • masterful_navigation_3:16.44%
  • masterful_navigation_4:15.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268899
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Masterful Navigation (_final) 5.4 0.0 52.0sec 52.0sec 17.54% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_masterful_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:600.00

Stack Uptimes

  • masterful_navigation_final_1:17.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268898
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Nightfall 26.5 1.9 11.1sec 10.3sec 13.33% 0.00% 1.9(1.9) 0.0

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_nightfall
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.80
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

RPPM Buff details

  • scaling:haste
  • frequency:4.00
  • modifier:1.00

Stack Uptimes

  • nightfall_1:13.33%

Trigger Attempt Success

  • trigger_pct:14.91%

Spelldata details

  • id:264571
  • name:Nightfall
  • tooltip:Your next Shadow Bolt is instant and deals {$s2=25}% increased damage.
  • description:{$@spelldesc108558=Corruption damage has a chance to cause your next Shadow Bolt to be instant and deal {$264571s2=25}% increased damage.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:108558
  • name:Nightfall
  • tooltip:
  • description:Corruption damage has a chance to cause your next Shadow Bolt to be instant and deal {$264571s2=25}% increased damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.3 2.7 68.1sec 38.7sec 42.70% 0.00% 2.7(36.7) 0.0

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.28%
  • overwhelming_power_2:1.31%
  • overwhelming_power_3:1.34%
  • overwhelming_power_4:1.37%
  • overwhelming_power_5:1.41%
  • overwhelming_power_6:1.44%
  • overwhelming_power_7:1.48%
  • overwhelming_power_8:1.52%
  • overwhelming_power_9:1.55%
  • overwhelming_power_10:1.59%
  • overwhelming_power_11:1.63%
  • overwhelming_power_12:1.68%
  • overwhelming_power_13:1.72%
  • overwhelming_power_14:1.77%
  • overwhelming_power_15:1.81%
  • overwhelming_power_16:1.86%
  • overwhelming_power_17:1.91%
  • overwhelming_power_18:1.96%
  • overwhelming_power_19:2.01%
  • overwhelming_power_20:2.07%
  • overwhelming_power_21:2.12%
  • overwhelming_power_22:2.18%
  • overwhelming_power_23:2.24%
  • overwhelming_power_24:2.29%
  • overwhelming_power_25:1.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
nightfall 28.4 10.3sec

Resources

Resource Usage Type Count Total Average RPE APR
Nightfall
agony Mana 16.0 15983.0 1000.0 1000.0 27.6
corruption Mana 20.1 20098.8 1000.0 1000.0 24.9
haunt Mana 18.4 36865.9 2000.0 2114.7 4.3
shadow_bolt Mana 103.3 206677.7 2000.0 2000.0 4.7
summon_darkglare Mana 2.0 4000.0 2000.0 2000.0 0.0
unstable_affliction Soul Shard 38.2 38.2 1.0 1.0 28483.3
pet - succubus
lash_of_pain Energy 64.5 3870.5 60.0 60.0 83.9
Resource Gains Type Count Total Average Overflow
agony Soul Shard 35.37 35.37 (97.52%) 1.00 0.00 0.00%
mana_regen Mana 595.09 280170.14 (100.00%) 470.80 19294.87 6.44%
unstable_affliction_refund Soul Shard 0.90 0.90 (2.48%) 1.00 0.00 0.00%
pet - darkglare
energy_regen Energy 31.60 0.00 (0.00%) 0.00 529.78 100.00%
pet - succubus
energy_regen Energy 2654.43 3700.12 (100.00%) 1.39 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 933.90 945.42
Soul Shard 0.12 0.13
Combat End Resource Mean Min Max
Mana 96548.79 89691.00 100000.00
Soul Shard 1.11 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.1%

Statistics & Data Analysis

Fight Length
Sample Data Nightfall Fight Length
Count 24999
Mean 300.00
Minimum 240.01
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data Nightfall Damage Per Second
Count 24999
Mean 16763.04
Minimum 15400.71
Maximum 18628.29
Spread ( max - min ) 3227.58
Range [ ( max - min ) / 2 * 100% ] 9.63%
Standard Deviation 408.8477
5th Percentile 16150.26
95th Percentile 17495.47
( 95th Percentile - 5th Percentile ) 1345.21
Mean Distribution
Standard Deviation 2.5858
95.00% Confidence Intervall ( 16757.97 - 16768.11 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2286
0.1 Scale Factor Error with Delta=300 1427
0.05 Scale Factor Error with Delta=300 5708
0.01 Scale Factor Error with Delta=300 142695
Priority Target DPS
Sample Data Nightfall Priority Target Damage Per Second
Count 24999
Mean 16763.04
Minimum 15400.71
Maximum 18628.29
Spread ( max - min ) 3227.58
Range [ ( max - min ) / 2 * 100% ] 9.63%
Standard Deviation 408.8477
5th Percentile 16150.26
95th Percentile 17495.47
( 95th Percentile - 5th Percentile ) 1345.21
Mean Distribution
Standard Deviation 2.5858
95.00% Confidence Intervall ( 16757.97 - 16768.11 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2286
0.1 Scale Factor Error with Delta=300 1427
0.05 Scale Factor Error with Delta=300 5708
0.01 Scale Factor Error with Delta=300 142695
DPS(e)
Sample Data Nightfall Damage Per Second (Effective)
Count 24999
Mean 16763.04
Minimum 15400.71
Maximum 18628.29
Spread ( max - min ) 3227.58
Range [ ( max - min ) / 2 * 100% ] 9.63%
Damage
Sample Data Nightfall Damage
Count 24999
Mean 4101337.00
Minimum 3136576.53
Maximum 5088479.93
Spread ( max - min ) 1951903.40
Range [ ( max - min ) / 2 * 100% ] 23.80%
DTPS
Sample Data Nightfall Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Nightfall Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Nightfall Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Nightfall Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Nightfall Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Nightfall Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data NightfallTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Nightfall Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 seed_of_corruption,if=spell_targets.seed_of_corruption_aoe>=3
8 0.00 haunt
9 0.00 shadow_bolt,if=!talent.haunt.enabled&spell_targets.seed_of_corruption_aoe<3
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=use_seed,value=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up|talent.siphon_life.enabled&spell_targets.seed_of_corruption>=5+raid_event.invulnerable.up|spell_targets.seed_of_corruption>=8+raid_event.invulnerable.up
0.00 variable,name=padding,op=set,value=action.shadow_bolt.execute_time*azerite.cascading_calamity.enabled
0.00 variable,name=padding,op=reset,value=gcd,if=azerite.cascading_calamity.enabled&(talent.drain_soul.enabled|talent.deathbolt.enabled&cooldown.deathbolt.remains<=gcd)
0.00 variable,name=maintain_se,value=spell_targets.seed_of_corruption_aoe<=1+talent.writhe_in_agony.enabled+talent.absolute_corruption.enabled*2+(talent.writhe_in_agony.enabled&talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>2)+(talent.siphon_life.enabled&!talent.creeping_death.enabled&!talent.drain_soul.enabled)+raid_event.invulnerable.up
A 0.00 call_action_list,name=cooldowns
0.00 drain_soul,interrupt_global=1,chain=1,cycle_targets=1,if=target.time_to_die<=gcd&soul_shard<5
B 17.50 haunt,if=spell_targets.seed_of_corruption_aoe<=2+raid_event.invulnerable.up
C 2.00 summon_darkglare,if=dot.agony.ticking&dot.corruption.ticking&(buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up)
0.00 deathbolt,if=cooldown.summon_darkglare.remains&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up
D 2.41 agony,target_if=min:dot.agony.remains,if=remains<=gcd+action.shadow_bolt.execute_time&target.time_to_die>8
E 0.21 unstable_affliction,target_if=!contagion&target.time_to_die<=8
0.00 drain_soul,target_if=min:debuff.shadow_embrace.remains,cancel_if=ticks_remain<5,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=gcd*2
0.00 shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=execute_time*2+travel_time&!action.shadow_bolt.in_flight
F 5.74 phantom_singularity,target_if=max:target.time_to_die,if=time>35&(cooldown.summon_darkglare.remains>=45|cooldown.summon_darkglare.remains<8)&target.time_to_die>16*spell_haste
0.00 vile_taint,target_if=max:target.time_to_die,if=time>15&target.time_to_die>=10
G 0.08 unstable_affliction,target_if=min:contagion,if=!variable.use_seed&soul_shard=5
0.00 seed_of_corruption,if=variable.use_seed&soul_shard=5
H 0.00 call_action_list,name=dots
I 1.00 phantom_singularity,if=time<=35
0.00 vile_taint,if=time<15
J 2.43 dark_soul,if=cooldown.summon_darkglare.remains<10&dot.phantom_singularity.remains|target.time_to_die<20+gcd|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up
0.00 berserking
K 0.00 call_action_list,name=spenders
L 0.00 call_action_list,name=fillers
actions.cooldowns
# count action,conditions
M 1.00 potion,if=(talent.dark_soul_misery.enabled&cooldown.summon_darkglare.up&cooldown.dark_soul.up)|cooldown.summon_darkglare.up|target.time_to_die<30
N 3.62 use_items,if=!cooldown.summon_darkglare.up,if=cooldown.summon_darkglare.remains>70|time_to_die<20|((buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains)&!cooldown.summon_darkglare.remains)
0.00 fireblood,if=!cooldown.summon_darkglare.up
0.00 blood_fury,if=!cooldown.summon_darkglare.up
actions.dots
# count action,conditions
0.00 seed_of_corruption,if=dot.corruption.remains<=action.seed_of_corruption.cast_time+time_to_shard+4.2*(1-talent.creeping_death.enabled*0.15)&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&!dot.seed_of_corruption.remains&!action.seed_of_corruption.in_flight
0.00 agony,target_if=min:remains,if=talent.creeping_death.enabled&active_dot.agony<6&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
O 13.58 agony,target_if=min:remains,if=!talent.creeping_death.enabled&active_dot.agony<8&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
P 18.88 siphon_life,target_if=min:remains,if=(active_dot.siphon_life<8-talent.creeping_death.enabled-spell_targets.sow_the_seeds_aoe)&target.time_to_die>10&refreshable&(!remains&spell_targets.seed_of_corruption_aoe=1|cooldown.summon_darkglare.remains>soul_shard*action.unstable_affliction.execute_time)
Q 20.10 corruption,cycle_targets=1,if=spell_targets.seed_of_corruption_aoe<3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)&target.time_to_die>10
actions.fillers
# count action,conditions
R 13.05 unstable_affliction,line_cd=15,if=cooldown.deathbolt.remains<=gcd*2&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains>20
S 0.00 call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&(dot.agony.remains<dot.agony.duration*0.75|dot.corruption.remains<dot.corruption.duration*0.75|dot.siphon_life.remains<dot.siphon_life.duration*0.75)&cooldown.deathbolt.remains<=action.agony.gcd*4&cooldown.summon_darkglare.remains>20
T 0.00 call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains<=soul_shard*action.agony.gcd+action.agony.gcd*3&(dot.agony.remains<dot.agony.duration*1|dot.corruption.remains<dot.corruption.duration*1|dot.siphon_life.remains<dot.siphon_life.duration*1)
0.00 deathbolt,if=cooldown.summon_darkglare.remains>=30+gcd|cooldown.summon_darkglare.remains>140
0.00 shadow_bolt,if=buff.movement.up&buff.nightfall.remains
0.00 agony,if=buff.movement.up&!(talent.siphon_life.enabled&(prev_gcd.1.agony&prev_gcd.2.agony&prev_gcd.3.agony)|prev_gcd.1.agony)
0.00 siphon_life,if=buff.movement.up&!(prev_gcd.1.siphon_life&prev_gcd.2.siphon_life&prev_gcd.3.siphon_life)
0.00 corruption,if=buff.movement.up&!prev_gcd.1.corruption&!talent.absolute_corruption.enabled
0.00 drain_life,if=(buff.inevitable_demise.stack>=85-(spell_targets.seed_of_corruption_aoe-raid_event.invulnerable.up>2)*20&(cooldown.deathbolt.remains>execute_time|!talent.deathbolt.enabled)&(cooldown.phantom_singularity.remains>execute_time|!talent.phantom_singularity.enabled)&(cooldown.dark_soul.remains>execute_time|!talent.dark_soul_misery.enabled)&(cooldown.vile_taint.remains>execute_time|!talent.vile_taint.enabled)&cooldown.summon_darkglare.remains>execute_time+10|buff.inevitable_demise.stack>30&target.time_to_die<=10)
0.00 haunt
0.00 drain_soul,interrupt_global=1,chain=1,interrupt=1,cycle_targets=1,if=target.time_to_die<=gcd
0.00 drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains
0.00 drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se
0.00 drain_soul,interrupt_global=1,chain=1,interrupt=1
0.00 shadow_bolt,cycle_targets=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains&!action.shadow_bolt.in_flight
0.00 shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se
U 104.12 shadow_bolt
actions.spenders
# count action,conditions
V 8.44 unstable_affliction,if=cooldown.summon_darkglare.remains<=soul_shard*execute_time&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=soul_shard*execute_time)
W 0.00 call_action_list,name=fillers,if=(cooldown.summon_darkglare.remains<time_to_shard*(6-soul_shard)|cooldown.summon_darkglare.up)&time_to_die>cooldown.summon_darkglare.remains
0.00 seed_of_corruption,if=variable.use_seed
X 1.03 unstable_affliction,if=!variable.use_seed&!prev_gcd.1.summon_darkglare&(talent.deathbolt.enabled&cooldown.deathbolt.remains<=execute_time&!azerite.cascading_calamity.enabled|(soul_shard>=5&spell_targets.seed_of_corruption_aoe<2|soul_shard>=2&spell_targets.seed_of_corruption_aoe>=2)&target.time_to_die>4+execute_time&spell_targets.seed_of_corruption_aoe=1|target.time_to_die<=8+execute_time*soul_shard)
Y 15.47 unstable_affliction,if=!variable.use_seed&contagion<=cast_time+variable.padding
0.00 unstable_affliction,cycle_targets=1,if=!variable.use_seed&(!talent.deathbolt.enabled|cooldown.deathbolt.remains>time_to_shard|soul_shard>1)&(!talent.vile_taint.enabled|soul_shard>1)&contagion<=cast_time+variable.padding&(!azerite.cascading_calamity.enabled|buff.cascading_calamity.remains>time_to_shard)

Sample Sequence

012368DPQIJVVVVVNCURUUUBUUUUPOQUUYURUUUBUUQPYUOUURUUUBFPQYUUORUUQBPYUUUROQUUPBYUUURQUOFPYBNUUUQYRUPOUUBYQUUUPYUOUUBQYUUFPUUQORBUUUPUUQUUOBRUPUUQUUUUBUDFJMPQVVVVNCURBUUUUUUOPQYUBRUUUUPOQYUUBFRUPQUUOYUUBQPYURUUUOUQBPYUUURUFOQPBNYUUUXUUUUX

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Nightfall 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Nightfall 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation Nightfall 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_succubus Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 8 haunt Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 default D agony Fluffy_Pillow 98000.0/100000: 98% mana | 3.0/5: 60% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.295 dots P siphon_life Fluffy_Pillow 98295.0/100000: 98% mana | 3.0/5: 60% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:02.294 dots Q corruption Fluffy_Pillow 99294.0/100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:03.293 default I phantom_singularity Fluffy_Pillow 99293.0/100000: 99% mana | 4.0/5: 80% soul_shard bloodlust, masterful_navigation, archive_of_the_titans, battle_potion_of_intellect
0:04.293 default J dark_soul Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, masterful_navigation, archive_of_the_titans, battle_potion_of_intellect
0:05.290 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, dark_soul, masterful_navigation(2), archive_of_the_titans(2), battle_potion_of_intellect
0:06.090 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, active_uas, dark_soul, masterful_navigation(2), archive_of_the_titans(2), battle_potion_of_intellect
0:06.889 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), dark_soul, masterful_navigation(3), archive_of_the_titans(2), battle_potion_of_intellect
0:07.688 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(3), dark_soul, masterful_navigation(3), archive_of_the_titans(2), battle_potion_of_intellect
0:08.485 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation(3), archive_of_the_titans(2), battle_potion_of_intellect
0:09.286 cooldowns N use_items Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(4), archive_of_the_titans(2), battle_potion_of_intellect
0:09.286 default C summon_darkglare Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(4), archive_of_the_titans(2), battle_potion_of_intellect, kindled_soul(100)
0:10.086 fillers U shadow_bolt Fluffy_Pillow 98800.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(4), archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(100)
0:11.150 fillers R unstable_affliction Fluffy_Pillow 97864.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(4), archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(95)
0:11.950 fillers U shadow_bolt Fluffy_Pillow 98664.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, nightfall, masterful_navigation(4), archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(90)
0:12.750 fillers U shadow_bolt Fluffy_Pillow 97464.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(4), archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(85)
0:13.815 fillers U shadow_bolt Fluffy_Pillow 96529.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation_final, archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(80)
0:14.880 default B haunt Fluffy_Pillow 95594.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation_final, archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(75)
0:15.802 fillers U shadow_bolt Fluffy_Pillow 94516.0/100000: 95% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation_final, archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(70)
0:16.867 fillers U shadow_bolt Fluffy_Pillow 93581.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation_final, archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(65)
0:17.933 fillers U shadow_bolt Fluffy_Pillow 92647.0/100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation_final, archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(60)
0:18.998 fillers U shadow_bolt Fluffy_Pillow 91712.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation_final, archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(55)
0:20.063 dots P siphon_life Fluffy_Pillow 90777.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation_final, archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(50)
0:20.861 dots O agony Fluffy_Pillow 91575.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation_final, archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(45)
0:21.660 dots Q corruption Fluffy_Pillow 91374.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation_final, archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(40)
0:22.459 fillers U shadow_bolt Fluffy_Pillow 91173.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation_final, archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(35)
0:23.523 fillers U shadow_bolt Fluffy_Pillow 90237.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(3), dark_soul, masterful_navigation, archive_of_the_titans(5), kindled_soul(30)
0:24.586 spenders Y unstable_affliction Fluffy_Pillow 89300.0/100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation, archive_of_the_titans(5), kindled_soul(25)
0:25.583 fillers U shadow_bolt Fluffy_Pillow 90297.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, nightfall, masterful_navigation, archive_of_the_titans(6), kindled_soul(20)
0:26.582 fillers R unstable_affliction Fluffy_Pillow 89296.0/100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation, archive_of_the_titans(6), kindled_soul(15)
0:27.583 fillers U shadow_bolt Fluffy_Pillow 90297.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), masterful_navigation, overwhelming_power(25), archive_of_the_titans(6), kindled_soul(10)
0:28.814 fillers U shadow_bolt Fluffy_Pillow 89528.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), masterful_navigation, overwhelming_power(24), archive_of_the_titans(6), kindled_soul(5)
0:30.050 fillers U shadow_bolt Fluffy_Pillow 88764.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), masterful_navigation, overwhelming_power(22), archive_of_the_titans(7)
0:31.292 default B haunt Fluffy_Pillow 88006.0/100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), masterful_navigation, overwhelming_power(21), archive_of_the_titans(7)
0:32.228 fillers U shadow_bolt Fluffy_Pillow 86942.0/100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), masterful_navigation, elemental_whirl_mastery, overwhelming_power(20), archive_of_the_titans(7)
0:33.476 fillers U shadow_bolt Fluffy_Pillow 86190.0/100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), masterful_navigation, elemental_whirl_mastery, overwhelming_power(19), archive_of_the_titans(7)
0:34.730 dots Q corruption Fluffy_Pillow 85444.0/100000: 85% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation, elemental_whirl_mastery, overwhelming_power(25), archive_of_the_titans(7)
0:35.656 dots P siphon_life Fluffy_Pillow 85370.0/100000: 85% mana | 2.0/5: 40% soul_shard bloodlust, masterful_navigation, elemental_whirl_mastery, overwhelming_power(24), archive_of_the_titans(8)
0:36.583 spenders Y unstable_affliction Fluffy_Pillow 86297.0/100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, masterful_navigation, elemental_whirl_mastery, overwhelming_power(23), archive_of_the_titans(8)
0:37.513 fillers U shadow_bolt Fluffy_Pillow 87227.0/100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation, elemental_whirl_mastery, overwhelming_power(22), archive_of_the_titans(8)
0:38.754 dots O agony Fluffy_Pillow 86468.0/100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation, elemental_whirl_mastery, overwhelming_power(21), archive_of_the_titans(8)
0:39.689 fillers U shadow_bolt Fluffy_Pillow 86403.0/100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation, elemental_whirl_mastery, overwhelming_power(20), archive_of_the_titans(8)
0:40.939 fillers U shadow_bolt Fluffy_Pillow 85653.0/100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation, elemental_whirl_mastery, overwhelming_power(19), archive_of_the_titans(9)
0:42.193 fillers R unstable_affliction Fluffy_Pillow 84907.0/100000: 85% mana | 3.0/5: 60% soul_shard active_uas, masterful_navigation(2), overwhelming_power(17), archive_of_the_titans(9)
0:43.421 fillers U shadow_bolt Fluffy_Pillow 86135.0/100000: 86% mana | 2.0/5: 40% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(16), archive_of_the_titans(9)
0:45.065 fillers U shadow_bolt Fluffy_Pillow 85779.0/100000: 86% mana | 2.0/5: 40% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(14), archive_of_the_titans(10)
0:46.719 fillers U shadow_bolt Fluffy_Pillow 85433.0/100000: 85% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), overwhelming_power(13), archive_of_the_titans(10)
0:48.376 default B haunt Fluffy_Pillow 85090.0/100000: 85% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), overwhelming_power(11), archive_of_the_titans(10)
0:49.628 default F phantom_singularity Fluffy_Pillow 84342.0/100000: 84% mana | 3.0/5: 60% soul_shard active_uas, nightfall, masterful_navigation(2), overwhelming_power(10), archive_of_the_titans(10)
0:50.885 dots P siphon_life Fluffy_Pillow 85599.0/100000: 86% mana | 3.0/5: 60% soul_shard active_uas, nightfall, masterful_navigation(2), overwhelming_power(9), archive_of_the_titans(11)
0:52.144 dots Q corruption Fluffy_Pillow 86858.0/100000: 87% mana | 3.0/5: 60% soul_shard nightfall, masterful_navigation(2), overwhelming_power(7), archive_of_the_titans(11)
0:53.413 spenders Y unstable_affliction Fluffy_Pillow 87127.0/100000: 87% mana | 3.0/5: 60% soul_shard nightfall, masterful_navigation(2), overwhelming_power(6), archive_of_the_titans(11)
0:54.685 fillers U shadow_bolt Fluffy_Pillow 88399.0/100000: 88% mana | 2.0/5: 40% soul_shard active_uas, nightfall, masterful_navigation(2), overwhelming_power(5), archive_of_the_titans(11)
0:55.962 fillers U shadow_bolt Fluffy_Pillow 87676.0/100000: 88% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), overwhelming_power(4), archive_of_the_titans(12)
0:57.667 dots O agony Fluffy_Pillow 87381.0/100000: 87% mana | 3.0/5: 60% soul_shard active_uas, masterful_navigation(2), overwhelming_power(2), archive_of_the_titans(12)
0:58.955 fillers R unstable_affliction Fluffy_Pillow 87669.0/100000: 88% mana | 3.0/5: 60% soul_shard active_uas, masterful_navigation(2), overwhelming_power, archive_of_the_titans(12)
1:00.247 fillers U shadow_bolt Fluffy_Pillow 88961.0/100000: 89% mana | 2.0/5: 40% soul_shard active_uas(2), masterful_navigation(2), archive_of_the_titans(13)
1:01.975 fillers U shadow_bolt Fluffy_Pillow 88689.0/100000: 89% mana | 2.0/5: 40% soul_shard active_uas(2), masterful_navigation(2), archive_of_the_titans(13)
1:03.702 dots Q corruption Fluffy_Pillow 88416.0/100000: 88% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(13)
1:04.998 default B haunt Fluffy_Pillow 88712.0/100000: 89% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(13)
1:06.294 dots P siphon_life Fluffy_Pillow 88008.0/100000: 88% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(14)
1:07.589 spenders Y unstable_affliction Fluffy_Pillow 89303.0/100000: 89% mana | 3.0/5: 60% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(14)
1:08.887 fillers U shadow_bolt Fluffy_Pillow 90601.0/100000: 91% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(14)
1:10.615 fillers U shadow_bolt Fluffy_Pillow 90329.0/100000: 90% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(15)
1:12.341 fillers U shadow_bolt Fluffy_Pillow 90055.0/100000: 90% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(15)
1:14.068 fillers R unstable_affliction Fluffy_Pillow 89782.0/100000: 90% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(15)
1:15.365 dots O agony Fluffy_Pillow 91079.0/100000: 91% mana | 1.0/5: 20% soul_shard active_uas(2), nightfall, masterful_navigation(4), archive_of_the_titans(16)
1:16.660 dots Q corruption Fluffy_Pillow 91374.0/100000: 91% mana | 2.0/5: 40% soul_shard active_uas(2), nightfall, masterful_navigation(4), archive_of_the_titans(16)
1:17.955 fillers U shadow_bolt Fluffy_Pillow 91669.0/100000: 92% mana | 2.0/5: 40% soul_shard active_uas, nightfall, masterful_navigation(4), archive_of_the_titans(16)
1:19.253 fillers U shadow_bolt Fluffy_Pillow 90967.0/100000: 91% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(16)
1:20.980 dots P siphon_life Fluffy_Pillow 90694.0/100000: 91% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(17)
1:22.278 default B haunt Fluffy_Pillow 91992.0/100000: 92% mana | 2.0/5: 40% soul_shard active_uas, nightfall, masterful_navigation_final, archive_of_the_titans(17)
1:23.574 spenders Y unstable_affliction Fluffy_Pillow 91288.0/100000: 91% mana | 3.0/5: 60% soul_shard nightfall, masterful_navigation_final, archive_of_the_titans(17)
1:24.869 fillers U shadow_bolt Fluffy_Pillow 92583.0/100000: 93% mana | 2.0/5: 40% soul_shard active_uas, nightfall, masterful_navigation_final, archive_of_the_titans(17)
1:26.165 fillers U shadow_bolt Fluffy_Pillow 91879.0/100000: 92% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(18)
1:27.893 fillers U shadow_bolt Fluffy_Pillow 91607.0/100000: 92% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(18)
1:29.622 fillers R unstable_affliction Fluffy_Pillow 91336.0/100000: 91% mana | 2.0/5: 40% soul_shard active_uas, archive_of_the_titans(18)
1:30.918 dots Q corruption Fluffy_Pillow 92632.0/100000: 93% mana | 2.0/5: 40% soul_shard active_uas(2), archive_of_the_titans(19)
1:32.214 fillers U shadow_bolt Fluffy_Pillow 92928.0/100000: 93% mana | 2.0/5: 40% soul_shard active_uas(2), archive_of_the_titans(19)
1:33.942 dots O agony Fluffy_Pillow 92656.0/100000: 93% mana | 2.0/5: 40% soul_shard active_uas, archive_of_the_titans(19)
1:35.240 default F phantom_singularity Fluffy_Pillow 92954.0/100000: 93% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation, archive_of_the_titans(20)
1:36.536 dots P siphon_life Fluffy_Pillow 94250.0/100000: 94% mana | 2.0/5: 40% soul_shard active_uas, nightfall, masterful_navigation, archive_of_the_titans(20)
1:37.832 spenders Y unstable_affliction Fluffy_Pillow 95546.0/100000: 96% mana | 2.0/5: 40% soul_shard active_uas, nightfall, masterful_navigation, overwhelming_power(25), archive_of_the_titans(20)
1:39.032 default B haunt Fluffy_Pillow 96746.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, nightfall, masterful_navigation, overwhelming_power(23), archive_of_the_titans(20)
1:40.238 cooldowns N use_items Fluffy_Pillow 95952.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas, nightfall, masterful_navigation, overwhelming_power(22), archive_of_the_titans(20)
1:40.238 fillers U shadow_bolt Fluffy_Pillow 95952.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas, nightfall, masterful_navigation, overwhelming_power(22), archive_of_the_titans(20), kindled_soul(100)
1:41.450 fillers U shadow_bolt Fluffy_Pillow 95164.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, overwhelming_power(21), archive_of_the_titans(20), kindled_soul(95)
1:43.070 fillers U shadow_bolt Fluffy_Pillow 94784.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, overwhelming_power(19), archive_of_the_titans(20), kindled_soul(90)
1:44.698 dots Q corruption Fluffy_Pillow 94412.0/100000: 94% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), overwhelming_power(18), archive_of_the_titans(20), kindled_soul(80)
1:45.924 spenders Y unstable_affliction Fluffy_Pillow 94638.0/100000: 95% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(2), overwhelming_power(17), archive_of_the_titans(20), kindled_soul(75)
1:47.155 fillers R unstable_affliction Fluffy_Pillow 95869.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), overwhelming_power(15), archive_of_the_titans(20), kindled_soul(70)
1:48.390 fillers U shadow_bolt Fluffy_Pillow 97104.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(14), archive_of_the_titans(20), kindled_soul(60)
1:50.043 dots P siphon_life Fluffy_Pillow 96757.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(12), archive_of_the_titans(20), kindled_soul(55)
1:51.291 dots O agony Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(11), archive_of_the_titans(20), kindled_soul(45)
1:52.545 fillers U shadow_bolt Fluffy_Pillow 98259.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(10), archive_of_the_titans(20), kindled_soul(40)
1:54.220 fillers U shadow_bolt Fluffy_Pillow 97934.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation(3), overwhelming_power(8), archive_of_the_titans(20), kindled_soul(35)
1:55.904 default B haunt Fluffy_Pillow 97618.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), overwhelming_power(7), archive_of_the_titans(20), kindled_soul(25)
1:57.173 spenders Y unstable_affliction Fluffy_Pillow 96887.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation(3), overwhelming_power(5), archive_of_the_titans(20), kindled_soul(20)
1:58.450 dots Q corruption Fluffy_Pillow 98164.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), overwhelming_power(4), archive_of_the_titans(20), kindled_soul(10)
1:59.730 fillers U shadow_bolt Fluffy_Pillow 98444.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), overwhelming_power(3), archive_of_the_titans(20), kindled_soul(5)
2:01.438 fillers U shadow_bolt Fluffy_Pillow 98002.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), overwhelming_power, archive_of_the_titans(20)
2:03.160 fillers U shadow_bolt Fluffy_Pillow 97724.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
2:04.888 dots P siphon_life Fluffy_Pillow 97452.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
2:06.183 spenders Y unstable_affliction Fluffy_Pillow 98747.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
2:07.481 fillers U shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
2:09.209 dots O agony Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
2:10.505 fillers U shadow_bolt Fluffy_Pillow 98301.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, nightfall, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
2:11.803 fillers U shadow_bolt Fluffy_Pillow 97599.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20)
2:13.532 default B haunt Fluffy_Pillow 97328.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
2:14.828 dots Q corruption Fluffy_Pillow 96624.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
2:16.126 spenders Y unstable_affliction Fluffy_Pillow 96922.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
2:17.422 fillers U shadow_bolt Fluffy_Pillow 98218.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
2:19.149 fillers U shadow_bolt Fluffy_Pillow 97945.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
2:20.876 default F phantom_singularity Fluffy_Pillow 97672.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20)
2:22.172 dots P siphon_life Fluffy_Pillow 98968.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, nightfall, masterful_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20)
2:23.470 fillers U shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, nightfall, masterful_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20)
2:24.768 fillers U shadow_bolt Fluffy_Pillow 99298.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20)
2:26.496 dots Q corruption Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard masterful_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20)
2:27.793 dots O agony Fluffy_Pillow 98302.0/100000: 98% mana | 1.0/5: 20% soul_shard elemental_whirl_mastery, overwhelming_power(25), archive_of_the_titans(20)
2:28.995 fillers R unstable_affliction Fluffy_Pillow 98504.0/100000: 99% mana | 1.0/5: 20% soul_shard elemental_whirl_mastery, overwhelming_power(24), archive_of_the_titans(20)
2:30.199 default B haunt Fluffy_Pillow 99708.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, elemental_whirl_mastery, overwhelming_power(22), archive_of_the_titans(20)
2:31.410 fillers U shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(21), archive_of_the_titans(20)
2:33.028 fillers U shadow_bolt Fluffy_Pillow 97622.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(19), archive_of_the_titans(20)
2:34.657 fillers U shadow_bolt Fluffy_Pillow 97251.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(18), archive_of_the_titans(20)
2:36.291 dots P siphon_life Fluffy_Pillow 96885.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(16), archive_of_the_titans(20)
2:37.526 fillers U shadow_bolt Fluffy_Pillow 98120.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, overwhelming_power(15), archive_of_the_titans(20)
2:39.174 fillers U shadow_bolt Fluffy_Pillow 97768.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation, overwhelming_power(13), archive_of_the_titans(20)
2:40.833 dots Q corruption Fluffy_Pillow 97427.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation, overwhelming_power(12), archive_of_the_titans(20)
2:42.083 fillers U shadow_bolt Fluffy_Pillow 97677.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation, overwhelming_power(10), archive_of_the_titans(20)
2:43.758 fillers U shadow_bolt Fluffy_Pillow 97352.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation, overwhelming_power(9), archive_of_the_titans(20)
2:45.438 dots O agony Fluffy_Pillow 97032.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation(2), overwhelming_power(7), archive_of_the_titans(20)
2:46.706 default B haunt Fluffy_Pillow 97300.0/100000: 97% mana | 2.0/5: 40% soul_shard masterful_navigation(3), overwhelming_power(6), archive_of_the_titans(20)
2:47.980 fillers R unstable_affliction Fluffy_Pillow 96574.0/100000: 97% mana | 2.0/5: 40% soul_shard masterful_navigation(3), overwhelming_power(5), archive_of_the_titans(20)
2:49.255 fillers U shadow_bolt Fluffy_Pillow 97849.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, nightfall, masterful_navigation(3), overwhelming_power(3), archive_of_the_titans(20)
2:50.538 dots P siphon_life Fluffy_Pillow 97132.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), overwhelming_power(2), archive_of_the_titans(20)
2:51.827 fillers U shadow_bolt Fluffy_Pillow 98421.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), overwhelming_power, archive_of_the_titans(20)
2:53.547 fillers U shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
2:55.275 dots Q corruption Fluffy_Pillow 97731.0/100000: 98% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
2:56.571 fillers U shadow_bolt Fluffy_Pillow 98027.0/100000: 98% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
2:58.300 fillers U shadow_bolt Fluffy_Pillow 97756.0/100000: 98% mana | 2.0/5: 40% soul_shard masterful_navigation(4), archive_of_the_titans(20)
3:00.027 fillers U shadow_bolt Fluffy_Pillow 97483.0/100000: 97% mana | 3.0/5: 60% soul_shard masterful_navigation(4), archive_of_the_titans(20)
3:01.756 fillers U shadow_bolt Fluffy_Pillow 97212.0/100000: 97% mana | 3.0/5: 60% soul_shard masterful_navigation_final, archive_of_the_titans(20)
3:03.483 default B haunt Fluffy_Pillow 96939.0/100000: 97% mana | 3.0/5: 60% soul_shard masterful_navigation_final, archive_of_the_titans(20)
3:04.781 fillers U shadow_bolt Fluffy_Pillow 96237.0/100000: 96% mana | 3.0/5: 60% soul_shard masterful_navigation_final, archive_of_the_titans(20)
3:06.510 default D agony Fluffy_Pillow 95966.0/100000: 96% mana | 3.0/5: 60% soul_shard masterful_navigation_final, archive_of_the_titans(20)
3:07.807 default F phantom_singularity Fluffy_Pillow 96263.0/100000: 96% mana | 3.0/5: 60% soul_shard masterful_navigation_final, archive_of_the_titans(20)
3:09.104 default J dark_soul Fluffy_Pillow 97560.0/100000: 98% mana | 3.0/5: 60% soul_shard masterful_navigation_final, elemental_whirl_crit, archive_of_the_titans(20)
3:10.401 cooldowns M potion Fluffy_Pillow 98857.0/100000: 99% mana | 3.0/5: 60% soul_shard dark_soul, nightfall, masterful_navigation_final, elemental_whirl_crit, archive_of_the_titans(20)
3:10.401 dots P siphon_life Fluffy_Pillow 98857.0/100000: 99% mana | 3.0/5: 60% soul_shard dark_soul, nightfall, masterful_navigation_final, elemental_whirl_crit, archive_of_the_titans(20), battle_potion_of_intellect
3:11.437 dots Q corruption Fluffy_Pillow 99893.0/100000: 100% mana | 4.0/5: 80% soul_shard dark_soul, nightfall, elemental_whirl_crit, archive_of_the_titans(20), battle_potion_of_intellect
3:12.476 spenders V unstable_affliction Fluffy_Pillow 99932.0/100000: 100% mana | 4.0/5: 80% soul_shard dark_soul, nightfall, elemental_whirl_crit, archive_of_the_titans(20), battle_potion_of_intellect
3:13.512 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard active_uas, dark_soul, nightfall, elemental_whirl_crit, archive_of_the_titans(20), battle_potion_of_intellect
3:14.549 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard active_uas(2), dark_soul, nightfall, elemental_whirl_crit, archive_of_the_titans(20), battle_potion_of_intellect
3:15.586 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard active_uas(3), dark_soul, nightfall, elemental_whirl_crit, archive_of_the_titans(20), battle_potion_of_intellect
3:16.624 cooldowns N use_items Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(4), dark_soul, nightfall, elemental_whirl_crit, archive_of_the_titans(20), battle_potion_of_intellect
3:16.624 default C summon_darkglare Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(4), dark_soul, nightfall, elemental_whirl_crit, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(100)
3:17.659 fillers U shadow_bolt Fluffy_Pillow 99035.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(4), dark_soul, nightfall, elemental_whirl_crit, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(95)
3:18.694 fillers R unstable_affliction Fluffy_Pillow 98070.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas(4), dark_soul, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(90)
3:19.731 default B haunt Fluffy_Pillow 99107.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(85)
3:20.812 fillers U shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(80)
3:22.194 fillers U shadow_bolt Fluffy_Pillow 97386.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(75)
3:23.574 fillers U shadow_bolt Fluffy_Pillow 96766.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(70)
3:24.957 fillers U shadow_bolt Fluffy_Pillow 96149.0/100000: 96% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(60)
3:26.340 fillers U shadow_bolt Fluffy_Pillow 95532.0/100000: 96% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(55)
3:27.724 fillers U shadow_bolt Fluffy_Pillow 94916.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas(5), dark_soul, masterful_navigation, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(45)
3:29.107 dots O agony Fluffy_Pillow 94299.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas(4), masterful_navigation, elemental_whirl_versatility, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(40)
3:30.403 dots P siphon_life Fluffy_Pillow 94595.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas(3), masterful_navigation, elemental_whirl_versatility, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(35)
3:31.701 dots Q corruption Fluffy_Pillow 95893.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), elemental_whirl_versatility, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(25)
3:32.997 spenders Y unstable_affliction Fluffy_Pillow 96189.0/100000: 96% mana | 1.0/5: 20% soul_shard masterful_navigation(2), elemental_whirl_versatility, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(20)
3:34.293 fillers U shadow_bolt Fluffy_Pillow 97485.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), elemental_whirl_versatility, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(15)
3:36.019 default B haunt Fluffy_Pillow 97211.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), elemental_whirl_versatility, archive_of_the_titans(20), kindled_soul(5)
3:37.316 fillers R unstable_affliction Fluffy_Pillow 96508.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), elemental_whirl_versatility, archive_of_the_titans(20)
3:38.613 fillers U shadow_bolt Fluffy_Pillow 97805.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(2), archive_of_the_titans(20)
3:40.340 fillers U shadow_bolt Fluffy_Pillow 97532.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(3), archive_of_the_titans(20)
3:42.066 fillers U shadow_bolt Fluffy_Pillow 97258.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(3), archive_of_the_titans(20)
3:43.793 fillers U shadow_bolt Fluffy_Pillow 96985.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
3:45.521 dots P siphon_life Fluffy_Pillow 96713.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
3:46.818 dots O agony Fluffy_Pillow 98010.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
3:48.115 dots Q corruption Fluffy_Pillow 98307.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
3:49.411 spenders Y unstable_affliction Fluffy_Pillow 98603.0/100000: 99% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
3:50.709 fillers U shadow_bolt Fluffy_Pillow 99901.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, nightfall, masterful_navigation(4), archive_of_the_titans(20)
3:52.005 fillers U shadow_bolt Fluffy_Pillow 99197.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
3:53.734 default B haunt Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
3:55.031 default F phantom_singularity Fluffy_Pillow 97303.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
3:56.330 fillers R unstable_affliction Fluffy_Pillow 98602.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
3:57.627 fillers U shadow_bolt Fluffy_Pillow 99899.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(4), archive_of_the_titans(20)
3:59.356 dots P siphon_life Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:00.652 dots Q corruption Fluffy_Pillow 99302.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:01.949 fillers U shadow_bolt Fluffy_Pillow 99599.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:03.677 fillers U shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:05.404 dots O agony Fluffy_Pillow 97732.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:06.700 spenders Y unstable_affliction Fluffy_Pillow 98028.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation_final, archive_of_the_titans(20)
4:07.997 fillers U shadow_bolt Fluffy_Pillow 99325.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, archive_of_the_titans(20)
4:09.724 fillers U shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, archive_of_the_titans(20)
4:11.452 default B haunt Fluffy_Pillow 97732.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, archive_of_the_titans(20)
4:12.748 dots Q corruption Fluffy_Pillow 97028.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(20)
4:14.046 dots P siphon_life Fluffy_Pillow 97326.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(20)
4:15.343 spenders Y unstable_affliction Fluffy_Pillow 98623.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(20)
4:16.640 fillers U shadow_bolt Fluffy_Pillow 99920.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20)
4:18.368 fillers R unstable_affliction Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), overwhelming_power(24), archive_of_the_titans(20)
4:19.574 fillers U shadow_bolt Fluffy_Pillow 99211.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), nightfall, masterful_navigation(4), overwhelming_power(23), archive_of_the_titans(20)
4:20.782 fillers U shadow_bolt Fluffy_Pillow 98419.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(4), overwhelming_power(22), archive_of_the_titans(20)
4:22.395 fillers U shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(4), elemental_whirl_versatility, overwhelming_power(20), archive_of_the_titans(20)
4:24.018 dots O agony Fluffy_Pillow 97627.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(4), elemental_whirl_versatility, overwhelming_power(18), archive_of_the_titans(20)
4:25.244 fillers U shadow_bolt Fluffy_Pillow 97853.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), elemental_whirl_versatility, overwhelming_power(17), archive_of_the_titans(20)
4:26.881 dots Q corruption Fluffy_Pillow 97490.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_versatility, overwhelming_power(16), archive_of_the_titans(20)
4:28.117 default B haunt Fluffy_Pillow 97726.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(4), elemental_whirl_versatility, overwhelming_power(14), archive_of_the_titans(20)
4:29.359 dots P siphon_life Fluffy_Pillow 96968.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation(4), elemental_whirl_versatility, overwhelming_power(13), archive_of_the_titans(20)
4:30.603 spenders Y unstable_affliction Fluffy_Pillow 98212.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(4), elemental_whirl_versatility, overwhelming_power(12), archive_of_the_titans(20)
4:31.850 fillers U shadow_bolt Fluffy_Pillow 99459.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, overwhelming_power(11), archive_of_the_titans(20)
4:33.520 fillers U shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, overwhelming_power(9), archive_of_the_titans(20)
4:35.202 fillers U shadow_bolt Fluffy_Pillow 97688.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, overwhelming_power(7), archive_of_the_titans(20)
4:36.892 fillers R unstable_affliction Fluffy_Pillow 97378.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, overwhelming_power(6), archive_of_the_titans(20)
4:38.163 fillers U shadow_bolt Fluffy_Pillow 98649.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation_final, overwhelming_power(4), archive_of_the_titans(20)
4:39.866 default F phantom_singularity Fluffy_Pillow 98002.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, overwhelming_power(3), archive_of_the_titans(20)
4:41.321 dots O agony Fluffy_Pillow 99457.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, nightfall, masterful_navigation_final, overwhelming_power, archive_of_the_titans(20)
4:42.613 dots Q corruption Fluffy_Pillow 99749.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, nightfall, archive_of_the_titans(20)
4:43.910 dots P siphon_life Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard active_uas, nightfall, archive_of_the_titans(20)
4:45.206 default B haunt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard active_uas, nightfall, archive_of_the_titans(20)
4:46.503 cooldowns N use_items Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard nightfall, archive_of_the_titans(20)
4:46.503 spenders Y unstable_affliction Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard nightfall, archive_of_the_titans(20), kindled_soul(100)
4:47.800 fillers U shadow_bolt Fluffy_Pillow 99302.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, nightfall, archive_of_the_titans(20), kindled_soul(95)
4:49.096 fillers U shadow_bolt Fluffy_Pillow 98598.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, nightfall, archive_of_the_titans(20), kindled_soul(90)
4:50.393 fillers U shadow_bolt Fluffy_Pillow 97895.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, archive_of_the_titans(20), kindled_soul(85)
4:52.119 spenders X unstable_affliction Fluffy_Pillow 97621.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, archive_of_the_titans(20), kindled_soul(75)
4:53.415 fillers U shadow_bolt Fluffy_Pillow 98917.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), nightfall, masterful_navigation(2), archive_of_the_titans(20), kindled_soul(70)
4:54.710 fillers U shadow_bolt Fluffy_Pillow 98212.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(2), archive_of_the_titans(20), kindled_soul(60)
4:56.436 fillers U shadow_bolt Fluffy_Pillow 97938.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20), kindled_soul(55)
4:58.165 fillers U shadow_bolt Fluffy_Pillow 97667.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20), kindled_soul(45)
4:59.892 spenders X unstable_affliction Fluffy_Pillow 97394.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(2), archive_of_the_titans(20), kindled_soul(35)

Stats

Level Bonus (120) Race Bonus (goblin) Raid-Buffed Unbuffed Gear Amount
Strength 1467 -3 1524 1464 0
Agility 1467 1 1528 1468 0
Stamina 1001 -1 9025 8205 7205
Intellect 1467 3 8169 7008 5205 (377)
Spirit 0 0 0 0 0
Health 180500 164100 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8169 7008 0
Crit 16.14% 16.14% 802
Haste 16.06% 16.06% 1014
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 62.35% 62.35% 1220
Armor 1165 1165 1165
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Visage of the Ascended Prophet
ilevel: 390, stats: { 155 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Mantle of Contained Corruption
ilevel: 390, stats: { 143 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 190 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 161 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 115 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Ring of the Infinite Void
ilevel: 385, stats: { +312 Sta, +240 Mastery, +191 Crit }, enchant: { +37 Mastery }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Mastery }
Local Trinket1 Balefire Branch
ilevel: 370, stats: { +164 Mastery }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 92 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: masterful_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Nightfall (Affliction Warlock) Drain Soul (Affliction Warlock) Deathbolt (Affliction Warlock)
30 Writhe in Agony (Affliction Warlock) Absolute Corruption (Affliction Warlock) Siphon Life (Affliction Warlock)
45 Demon Skin Burning Rush Dark Pact
60 Sow the Seeds (Affliction Warlock) Phantom Singularity Vile Taint (Affliction Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Shadow Embrace (Affliction Warlock) Haunt (Affliction Warlock) Grimoire of Sacrifice
100 Soul Conduit Creeping Death (Affliction Warlock) Dark Soul: Misery (Affliction Warlock)

Profile

warlock="Nightfall"
source=default
spec=affliction
level=120
race=goblin
role=spell
position=ranged_back
talents=1302023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/seed_of_corruption,if=spell_targets.seed_of_corruption_aoe>=3
actions.precombat+=/haunt
actions.precombat+=/shadow_bolt,if=!talent.haunt.enabled&spell_targets.seed_of_corruption_aoe<3

# Executed every time the actor is available.
actions=variable,name=use_seed,value=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up|talent.siphon_life.enabled&spell_targets.seed_of_corruption>=5+raid_event.invulnerable.up|spell_targets.seed_of_corruption>=8+raid_event.invulnerable.up
actions+=/variable,name=padding,op=set,value=action.shadow_bolt.execute_time*azerite.cascading_calamity.enabled
actions+=/variable,name=padding,op=reset,value=gcd,if=azerite.cascading_calamity.enabled&(talent.drain_soul.enabled|talent.deathbolt.enabled&cooldown.deathbolt.remains<=gcd)
actions+=/variable,name=maintain_se,value=spell_targets.seed_of_corruption_aoe<=1+talent.writhe_in_agony.enabled+talent.absolute_corruption.enabled*2+(talent.writhe_in_agony.enabled&talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>2)+(talent.siphon_life.enabled&!talent.creeping_death.enabled&!talent.drain_soul.enabled)+raid_event.invulnerable.up
actions+=/call_action_list,name=cooldowns
actions+=/drain_soul,interrupt_global=1,chain=1,cycle_targets=1,if=target.time_to_die<=gcd&soul_shard<5
actions+=/haunt,if=spell_targets.seed_of_corruption_aoe<=2+raid_event.invulnerable.up
actions+=/summon_darkglare,if=dot.agony.ticking&dot.corruption.ticking&(buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up)
actions+=/deathbolt,if=cooldown.summon_darkglare.remains&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up
actions+=/agony,target_if=min:dot.agony.remains,if=remains<=gcd+action.shadow_bolt.execute_time&target.time_to_die>8
actions+=/unstable_affliction,target_if=!contagion&target.time_to_die<=8
actions+=/drain_soul,target_if=min:debuff.shadow_embrace.remains,cancel_if=ticks_remain<5,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=gcd*2
actions+=/shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=execute_time*2+travel_time&!action.shadow_bolt.in_flight
actions+=/phantom_singularity,target_if=max:target.time_to_die,if=time>35&(cooldown.summon_darkglare.remains>=45|cooldown.summon_darkglare.remains<8)&target.time_to_die>16*spell_haste
actions+=/vile_taint,target_if=max:target.time_to_die,if=time>15&target.time_to_die>=10
actions+=/unstable_affliction,target_if=min:contagion,if=!variable.use_seed&soul_shard=5
actions+=/seed_of_corruption,if=variable.use_seed&soul_shard=5
actions+=/call_action_list,name=dots
actions+=/phantom_singularity,if=time<=35
actions+=/vile_taint,if=time<15
actions+=/dark_soul,if=cooldown.summon_darkglare.remains<10&dot.phantom_singularity.remains|target.time_to_die<20+gcd|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up
actions+=/berserking
actions+=/call_action_list,name=spenders
actions+=/call_action_list,name=fillers

actions.cooldowns=potion,if=(talent.dark_soul_misery.enabled&cooldown.summon_darkglare.up&cooldown.dark_soul.up)|cooldown.summon_darkglare.up|target.time_to_die<30
actions.cooldowns+=/use_items,if=!cooldown.summon_darkglare.up,if=cooldown.summon_darkglare.remains>70|time_to_die<20|((buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains)&!cooldown.summon_darkglare.remains)
actions.cooldowns+=/fireblood,if=!cooldown.summon_darkglare.up
actions.cooldowns+=/blood_fury,if=!cooldown.summon_darkglare.up

actions.db_refresh=siphon_life,line_cd=15,if=(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.corruption.remains%dot.corruption.duration)&dot.siphon_life.remains<dot.siphon_life.duration*1.3
actions.db_refresh+=/agony,line_cd=15,if=(dot.agony.remains%dot.agony.duration)<=(dot.corruption.remains%dot.corruption.duration)&(dot.agony.remains%dot.agony.duration)<=(dot.siphon_life.remains%dot.siphon_life.duration)&dot.agony.remains<dot.agony.duration*1.3
actions.db_refresh+=/corruption,line_cd=15,if=(dot.corruption.remains%dot.corruption.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.corruption.remains%dot.corruption.duration)<=(dot.siphon_life.remains%dot.siphon_life.duration)&dot.corruption.remains<dot.corruption.duration*1.3

actions.dots=seed_of_corruption,if=dot.corruption.remains<=action.seed_of_corruption.cast_time+time_to_shard+4.2*(1-talent.creeping_death.enabled*0.15)&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&!dot.seed_of_corruption.remains&!action.seed_of_corruption.in_flight
actions.dots+=/agony,target_if=min:remains,if=talent.creeping_death.enabled&active_dot.agony<6&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
actions.dots+=/agony,target_if=min:remains,if=!talent.creeping_death.enabled&active_dot.agony<8&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
actions.dots+=/siphon_life,target_if=min:remains,if=(active_dot.siphon_life<8-talent.creeping_death.enabled-spell_targets.sow_the_seeds_aoe)&target.time_to_die>10&refreshable&(!remains&spell_targets.seed_of_corruption_aoe=1|cooldown.summon_darkglare.remains>soul_shard*action.unstable_affliction.execute_time)
actions.dots+=/corruption,cycle_targets=1,if=spell_targets.seed_of_corruption_aoe<3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)&target.time_to_die>10

actions.fillers=unstable_affliction,line_cd=15,if=cooldown.deathbolt.remains<=gcd*2&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains>20
actions.fillers+=/call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&(dot.agony.remains<dot.agony.duration*0.75|dot.corruption.remains<dot.corruption.duration*0.75|dot.siphon_life.remains<dot.siphon_life.duration*0.75)&cooldown.deathbolt.remains<=action.agony.gcd*4&cooldown.summon_darkglare.remains>20
actions.fillers+=/call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains<=soul_shard*action.agony.gcd+action.agony.gcd*3&(dot.agony.remains<dot.agony.duration*1|dot.corruption.remains<dot.corruption.duration*1|dot.siphon_life.remains<dot.siphon_life.duration*1)
actions.fillers+=/deathbolt,if=cooldown.summon_darkglare.remains>=30+gcd|cooldown.summon_darkglare.remains>140
actions.fillers+=/shadow_bolt,if=buff.movement.up&buff.nightfall.remains
actions.fillers+=/agony,if=buff.movement.up&!(talent.siphon_life.enabled&(prev_gcd.1.agony&prev_gcd.2.agony&prev_gcd.3.agony)|prev_gcd.1.agony)
actions.fillers+=/siphon_life,if=buff.movement.up&!(prev_gcd.1.siphon_life&prev_gcd.2.siphon_life&prev_gcd.3.siphon_life)
actions.fillers+=/corruption,if=buff.movement.up&!prev_gcd.1.corruption&!talent.absolute_corruption.enabled
actions.fillers+=/drain_life,if=(buff.inevitable_demise.stack>=85-(spell_targets.seed_of_corruption_aoe-raid_event.invulnerable.up>2)*20&(cooldown.deathbolt.remains>execute_time|!talent.deathbolt.enabled)&(cooldown.phantom_singularity.remains>execute_time|!talent.phantom_singularity.enabled)&(cooldown.dark_soul.remains>execute_time|!talent.dark_soul_misery.enabled)&(cooldown.vile_taint.remains>execute_time|!talent.vile_taint.enabled)&cooldown.summon_darkglare.remains>execute_time+10|buff.inevitable_demise.stack>30&target.time_to_die<=10)
actions.fillers+=/haunt
actions.fillers+=/drain_soul,interrupt_global=1,chain=1,interrupt=1,cycle_targets=1,if=target.time_to_die<=gcd
actions.fillers+=/drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains
actions.fillers+=/drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se
actions.fillers+=/drain_soul,interrupt_global=1,chain=1,interrupt=1
actions.fillers+=/shadow_bolt,cycle_targets=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains&!action.shadow_bolt.in_flight
actions.fillers+=/shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se
actions.fillers+=/shadow_bolt

actions.spenders=unstable_affliction,if=cooldown.summon_darkglare.remains<=soul_shard*execute_time&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=soul_shard*execute_time)
actions.spenders+=/call_action_list,name=fillers,if=(cooldown.summon_darkglare.remains<time_to_shard*(6-soul_shard)|cooldown.summon_darkglare.up)&time_to_die>cooldown.summon_darkglare.remains
actions.spenders+=/seed_of_corruption,if=variable.use_seed
actions.spenders+=/unstable_affliction,if=!variable.use_seed&!prev_gcd.1.summon_darkglare&(talent.deathbolt.enabled&cooldown.deathbolt.remains<=execute_time&!azerite.cascading_calamity.enabled|(soul_shard>=5&spell_targets.seed_of_corruption_aoe<2|soul_shard>=2&spell_targets.seed_of_corruption_aoe>=2)&target.time_to_die>4+execute_time&spell_targets.seed_of_corruption_aoe=1|target.time_to_die<=8+execute_time*soul_shard)
actions.spenders+=/unstable_affliction,if=!variable.use_seed&contagion<=cast_time+variable.padding
actions.spenders+=/unstable_affliction,cycle_targets=1,if=!variable.use_seed&(!talent.deathbolt.enabled|cooldown.deathbolt.remains>time_to_shard|soul_shard>1)&(!talent.vile_taint.enabled|soul_shard>1)&contagion<=cast_time+variable.padding&(!azerite.cascading_calamity.enabled|buff.cascading_calamity.remains>time_to_shard)

head=visage_of_the_ascended_prophet,id=160719,bonus_id=4824/1507/4775,azerite_powers=483/21/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=mantle_of_contained_corruption,id=160613,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=ring_of_the_infinite_void,id=160647,bonus_id=4800/1507,enchant=pact_of_mastery
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_mastery
trinket1=balefire_branch,id=159630,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=masterful_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5205
# gear_crit_rating=802
# gear_haste_rating=1014
# gear_mastery_rating=1220
# gear_versatility_rating=129
# gear_armor=1165
default_pet=succubus

No_Talent : 16116 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16116.3 16116.3 4.9 / 0.030% 1514.7 / 9.4% 14.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
923.5 912.5 Mana 0.00% 45.5 100.0% 100%
Talents
  • 30: Siphon Life (Affliction Warlock)
  • 60: Phantom Singularity
  • 90: Haunt (Affliction Warlock)
  • 100: Dark Soul: Misery (Affliction Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
No_Talent 16116
Agony 1470 9.1% 16.0 18.61sec 27585 22653 Periodic 192.2 1970 3941 2294 16.5% 99.6%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.98 0.00 192.16 192.16 1.2178 1.5544 440863.02 440863.02 0.00 1385.69 22652.50
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 160.5 83.54% 1969.73 1 3075 1969.27 1910 2032 316194 316194 0.00
crit 31.6 16.46% 3941.04 9 6150 3940.10 3455 4301 124669 124669 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=gcd+action.shadow_bolt.execute_time&target.time_to_die>8
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.008000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Corruption 1665 10.4% 20.1 14.69sec 24852 20682 Periodic 190.3 2254 4508 2625 16.5% 98.1%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.10 0.00 190.27 190.27 1.2016 1.5471 499474.36 499474.36 0.00 1568.15 20682.17
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 159.0 83.54% 2254.16 1 3459 2254.19 2177 2320 358303 358303 0.00
crit 31.3 16.46% 4507.86 3 6919 4507.83 3934 4922 141171 141171 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.090000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Haunt 528 3.3% 17.4 16.76sec 9084 7544 Direct 18.4 7403 14809 8619 16.4%  

Stats details: haunt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.44 18.38 0.00 0.00 1.2042 0.0000 158443.73 158443.73 0.00 7544.22 7544.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.36 83.57% 7402.81 6235 10991 7403.61 6800 7973 113728 113728 0.00
crit 3.02 16.43% 14808.95 12470 21812 14210.09 0 21474 44716 44716 0.00
 
 

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:48181
  • name:Haunt
  • school:shadow
  • tooltip:Taking {$s2=10}% increased damage from the Warlock. Haunt's cooldown will be reset on death.
  • description:A ghostly soul haunts the target, dealing {$s1=0} Shadow damage and increasing your damage dealt to the target by {$s2=10}% for {$d=15 seconds}. If the target dies, Haunt's cooldown is reset.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25
 
Heed My Call 158 (226) 1.0% (1.4%) 7.0 38.23sec 9654 0 Direct 7.0 5802 11602 6760 16.5%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.0000 0.0000 47490.43 47490.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.86 83.48% 5801.52 4925 6141 5796.78 0 6141 34023 34023 0.00
crit 1.16 16.52% 11602.31 9849 12282 8069.54 0 12282 13467 13467 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 68 0.4% 7.0 38.23sec 2894 0 Direct 7.0 2486 4973 2894 16.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.0000 0.0000 20331.51 20331.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.87 83.60% 2486.29 2111 2632 2484.55 0 2632 14603 14603 0.00
crit 1.15 16.40% 4973.20 4221 5264 3446.86 0 5264 5729 5729 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
  • base_dd_mult:1.00
 
Phantom Singularity 1102 6.8% 6.7 45.81sec 48963 39947 Periodic 70.1 4703 0 4703 0.0% 34.6%

Stats details: phantom_singularity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.73 0.00 70.10 70.10 1.2258 1.4795 329641.94 329641.94 0.00 2944.28 39946.91
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.1 100.00% 4702.70 4 6919 4703.98 4477 5014 329642 329642 0.00
 
 

Action details: phantom_singularity

Static Values
  • id:205179
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time>35&(cooldown.summon_darkglare.remains>=45|cooldown.summon_darkglare.remains<8)&target.time_to_die>16*spell_haste
Spelldata
  • id:205179
  • name:Phantom Singularity
  • school:shadow
  • tooltip:Dealing damage to all nearby targets every $t1 sec and healing the casting Warlock.
  • description:Places a phantom singularity above the target, which consumes the life of all enemies within $205246A2 yards, dealing ${8*{$205246s2=0 + 18.0%}} damage over {$d=16 seconds}, healing you for ${$205246e2*100}% of the damage done.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 

Action details: phantom_singularity_tick

Static Values
  • id:205246
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205246
  • name:Phantom Singularity
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205179=Places a phantom singularity above the target, which consumes the life of all enemies within $205246A2 yards, dealing ${8*{$205246s2=0 + 18.0%}} damage over {$d=16 seconds}, healing you for ${$205246e2*100}% of the damage done.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.180000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25
 
Shadow Bolt 2607 16.2% 100.0 2.91sec 7813 5029 Direct 99.2 6764 13528 7878 16.5%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.05 99.22 0.00 0.00 1.5535 0.0000 781615.28 781615.28 0.00 5028.89 5028.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.88 83.53% 6763.62 5189 8854 6763.85 6530 6926 560581 560581 0.00
crit 16.34 16.47% 13527.70 10378 17708 13528.12 12337 15690 221034 221034 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:232670
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.haunt.enabled&spell_targets.seed_of_corruption_aoe<3
Spelldata
  • id:232670
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25
 
Siphon Life 1483 9.2% 18.9 15.73sec 23562 19695 Periodic 127.6 2993 5986 3485 16.5% 98.6%

Stats details: siphon_life

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.88 0.00 127.63 127.63 1.1964 2.3180 444841.40 444841.40 0.00 1396.96 19694.58
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.6 83.54% 2992.79 1 4613 2992.60 2886 3085 319100 319100 0.00
crit 21.0 16.46% 5986.25 3 9225 5986.07 4950 6609 125741 125741 0.00
 
 

Action details: siphon_life

Static Values
  • id:63106
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.corruption.remains%dot.corruption.duration)&dot.siphon_life.remains<dot.siphon_life.duration*1.3
Spelldata
  • id:63106
  • name:Siphon Life
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and siphoning life to the casting Warlock.
  • description:Siphons the target's life essence, dealing $o1 Shadow damage over {$d=15 seconds} and healing you for ${$e1*100}% of the damage done.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.120000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Unstable Affliction 0 (3637) 0.0% (22.5%) 38.1 7.80sec 28503 25082

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.14 0.00 0.00 0.00 1.1364 0.0000 0.00 0.00 0.00 25081.89 25081.89
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
 
    Unstable Affliction (_1) 1696 10.6% 0.0 0.00sec 0 0 Periodic 106.4 4109 8218 4786 16.5% 57.4%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 106.39 106.39 0.0000 1.6178 509153.70 509153.70 0.00 2958.15 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.9 83.53% 4108.77 2 6150 4109.28 3955 4291 365145 365145 0.00
crit 17.5 16.47% 8218.47 4 12300 8219.55 6968 9335 144009 144009 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 1103 6.8% 0.0 0.00sec 0 0 Periodic 68.3 4154 8309 4839 16.5% 37.3%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 68.26 68.26 0.0000 1.6400 330308.19 330308.19 0.00 2950.39 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.0 83.53% 4154.35 9 6150 4157.35 3987 4521 236886 236886 0.00
crit 11.2 16.47% 8309.20 53 12300 8315.23 0 10370 93422 93422 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 329 2.0% 0.0 0.00sec 0 0 Periodic 18.0 4637 9269 5398 16.4% 10.7%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 18.05 18.05 0.0000 1.7742 97422.89 97422.89 0.00 3042.75 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.1 83.57% 4637.10 142 6150 4637.44 4249 5103 69932 69932 0.00
crit 3.0 16.43% 9269.31 1389 12300 8896.71 0 11935 27491 27491 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 308 1.9% 0.0 0.00sec 0 0 Periodic 16.9 4621 9243 5383 16.5% 10.0%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 16.95 16.95 0.0000 1.7656 91228.91 91228.91 0.00 3048.99 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.2 83.50% 4620.80 3517 6150 4618.75 4163 5101 65387 65387 0.00
crit 2.8 16.50% 9242.69 7432 12300 8767.22 0 12205 25842 25842 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 200 1.2% 0.0 0.00sec 0 0 Periodic 10.9 4669 9344 5439 16.5% 6.1%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 10.86 10.86 0.0000 1.6780 59086.04 59086.04 0.00 3241.32 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.1 83.55% 4669.48 3550 6103 4582.10 0 5677 42383 42383 0.00
crit 1.8 16.45% 9344.48 7316 12205 7602.89 0 11843 16703 16703 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Taking {$30108s3=10}% increased damage from the Warlock.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. You deal {$s3=10}% increased damage to targets affected by your Unstable Affliction. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.160000
  • base_td:0.00
  • base_td_mult:1.25
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Volatile Blood Explosion 326 2.0% 7.1 37.94sec 13839 0 Direct 7.0 12060 24129 14042 16.4%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.06 6.96 0.00 0.00 0.0000 0.0000 97726.99 97726.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.82 83.58% 12060.13 10240 12770 12049.80 0 12770 70154 70154 0.00
crit 1.14 16.42% 24129.11 20481 25540 16634.91 0 25540 27573 27573 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies. Deals increased damage when striking multiple targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
  • base_dd_mult:1.00
 
pet - darkglare 5741 / 776
Eye Beam (dark_glare) 5741 4.8% 31.6 6.71sec 7265 5941 Direct 31.6 6240 12485 7265 16.4%  

Stats details: dark_glare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.61 31.61 0.00 0.00 1.2228 0.0000 229622.27 229622.27 0.00 5941.38 5941.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.42 83.59% 6240.02 3792 7971 6240.58 5735 6801 164856 164856 0.00
crit 5.19 16.41% 12485.03 7584 15942 12440.20 0 15572 64767 64767 0.00
 
 

Action details: dark_glare

Static Values
  • id:205231
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205231
  • name:Eye Beam
  • school:shadow
  • tooltip:
  • description:Fires an eye beam that deals {$s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.256000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
 
pet - succubus 2296 / 2296
Lash of Pain 1083 6.7% 64.5 4.74sec 5032 6105 Direct 64.5 4321 8646 5032 16.4%  

Stats details: lash_of_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.51 64.51 0.00 0.00 0.8242 0.0000 324591.43 324591.43 0.00 6104.79 6104.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.92 83.58% 4321.32 3889 5698 4321.32 4216 4411 232990 232990 0.00
crit 10.59 16.42% 8646.22 7778 11396 8645.54 0 10589 91602 91602 0.00
 
 

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:7814
  • name:Lash of Pain
  • school:shadow
  • tooltip:
  • description:Lashes the target, dealing {$s1=0} Shadow damage. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
 
melee 1213 7.5% 123.8 2.43sec 2937 1217 Direct 123.8 2523 5044 2937 16.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.82 123.82 0.00 0.00 2.4127 0.0000 363626.22 519847.35 30.05 1217.21 1217.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 103.48 83.57% 2522.59 2267 3321 2522.63 2469 2564 261034 373179 30.05
crit 20.34 16.43% 5044.37 4534 6643 5044.67 4769 5495 102592 146668 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
No_Talent
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:No_Talent
  • harmful:false
  • if_expr:
 
Dark Soul: Misery (dark_soul) 2.4 167.99sec

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.43 0.00 0.00 0.00 1.1550 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dark_soul

Static Values
  • id:113860
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_darkglare.remains<10&dot.phantom_singularity.remains|target.time_to_die<20+gcd|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up
Spelldata
  • id:113860
  • name:Dark Soul: Misery
  • school:shadow
  • tooltip:Haste increased by {$s1=30}%.
  • description:Infuses your soul with the misery of fallen foes, increasing haste by {$s1=30}% for {$d=20 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:No_Talent
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:No_Talent
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Darkglare 2.0 187.17sec

Stats details: summon_darkglare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8997 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_darkglare

Static Values
  • id:205180
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.agony.ticking&dot.corruption.ticking&(buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up)
Spelldata
  • id:205180
  • name:Summon Darkglare
  • school:shadow
  • tooltip:Summons a Darkglare from the Twisting Nether that blasts its target for Shadow damage, dealing increased damage for every damage over time effect you have active on any target.
  • description:Summons a Darkglare from the Twisting Nether that extends the duration of your damage over time effects on all enemies by {$s2=8} sec. The Darkglare will serve you for {$d=20 seconds}, blasting its target for {$205231s1=0} Shadow damage, increased by {$s3=10}% for every damage over time effect you have active on any target.
 
Summon Succubus 1.0 0.00sec

Stats details: summon_succubus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_succubus

Static Values
  • id:712
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:712
  • name:Summon Succubus
  • school:shadow
  • tooltip:
  • description:Summons a Succubus under your command to seduce enemy Humanoids, preventing them from attacking.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
active_uas 19.1 18.5 15.7sec 0.0sec 76.53% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • active_uas_1:55.21%
  • active_uas_2:10.91%
  • active_uas_3:1.67%
  • active_uas_4:3.50%
  • active_uas_5:5.24%
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:42.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dark Soul: Misery (dark_soul) 2.4 0.0 168.0sec 168.0sec 15.47% 0.00% 0.0(0.0) 2.1

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dark_soul_1:15.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:113860
  • name:Dark Soul: Misery
  • tooltip:Haste increased by {$s1=30}%.
  • description:Infuses your soul with the misery of fallen foes, increasing haste by {$s1=30}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.6 0.2 74.0sec 65.6sec 8.72% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_crit_1:8.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 74.2sec 65.8sec 8.75% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_haste_1:8.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.6 0.2 73.6sec 65.3sec 8.80% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_mastery_1:8.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 73.6sec 65.2sec 8.74% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_versatility_1:8.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 92.8sec 92.8sec 23.53% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Buff details

  • stat:intellect
  • amount:16.00

Stack Uptimes

  • kindled_soul_5:1.15%
  • kindled_soul_10:1.15%
  • kindled_soul_15:1.16%
  • kindled_soul_20:1.16%
  • kindled_soul_25:1.16%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.17%
  • kindled_soul_40:1.17%
  • kindled_soul_45:1.17%
  • kindled_soul_50:1.18%
  • kindled_soul_55:1.18%
  • kindled_soul_60:1.18%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.19%
  • kindled_soul_75:1.19%
  • kindled_soul_80:1.19%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.20%
  • kindled_soul_95:1.20%
  • kindled_soul_100:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by $w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining ${$268998U1*{$268998s1=9}} Intellect, which decays over $D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Masterful Navigation 6.0 22.4 52.1sec 10.3sec 66.89% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_masterful_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:50.00

Stack Uptimes

  • masterful_navigation_1:17.50%
  • masterful_navigation_2:17.01%
  • masterful_navigation_3:16.41%
  • masterful_navigation_4:15.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268899
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Masterful Navigation (_final) 5.4 0.0 52.1sec 52.1sec 17.50% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_masterful_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:600.00

Stack Uptimes

  • masterful_navigation_final_1:17.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268898
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.6 68.1sec 38.9sec 42.68% 0.00% 2.6(36.1) 0.0

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.28%
  • overwhelming_power_2:1.31%
  • overwhelming_power_3:1.34%
  • overwhelming_power_4:1.38%
  • overwhelming_power_5:1.41%
  • overwhelming_power_6:1.44%
  • overwhelming_power_7:1.48%
  • overwhelming_power_8:1.52%
  • overwhelming_power_9:1.56%
  • overwhelming_power_10:1.59%
  • overwhelming_power_11:1.64%
  • overwhelming_power_12:1.68%
  • overwhelming_power_13:1.72%
  • overwhelming_power_14:1.77%
  • overwhelming_power_15:1.81%
  • overwhelming_power_16:1.86%
  • overwhelming_power_17:1.91%
  • overwhelming_power_18:1.96%
  • overwhelming_power_19:2.01%
  • overwhelming_power_20:2.06%
  • overwhelming_power_21:2.12%
  • overwhelming_power_22:2.17%
  • overwhelming_power_23:2.23%
  • overwhelming_power_24:2.28%
  • overwhelming_power_25:1.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
No_Talent
agony Mana 16.0 15981.8 1000.0 1000.0 27.6
corruption Mana 20.1 20098.1 1000.0 1000.0 24.9
haunt Mana 18.4 36883.9 2000.0 2114.7 4.3
shadow_bolt Mana 100.0 200090.1 2000.0 2000.0 3.9
summon_darkglare Mana 2.0 4000.0 2000.0 2000.0 0.0
unstable_affliction Soul Shard 38.1 38.1 1.0 1.0 28502.6
pet - succubus
lash_of_pain Energy 64.5 3870.6 60.0 60.0 83.9
Resource Gains Type Count Total Average Overflow
agony Soul Shard 35.36 35.36 (97.52%) 1.00 0.00 0.00%
mana_regen Mana 601.28 273743.77 (100.00%) 455.26 25716.39 8.59%
unstable_affliction_refund Soul Shard 0.90 0.90 (2.48%) 1.00 0.00 0.00%
pet - darkglare
energy_regen Energy 31.61 0.00 (0.00%) 0.00 529.82 100.00%
pet - succubus
energy_regen Energy 2654.40 3700.04 (100.00%) 1.39 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 912.47 923.51
Soul Shard 0.12 0.13
Combat End Resource Mean Min Max
Mana 96686.73 91145.00 100000.00
Soul Shard 1.11 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.4%

Statistics & Data Analysis

Fight Length
Sample Data No_Talent Fight Length
Count 24999
Mean 300.00
Minimum 240.01
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data No_Talent Damage Per Second
Count 24999
Mean 16116.27
Minimum 14763.76
Maximum 17798.26
Spread ( max - min ) 3034.50
Range [ ( max - min ) / 2 * 100% ] 9.41%
Standard Deviation 392.2058
5th Percentile 15529.87
95th Percentile 16820.33
( 95th Percentile - 5th Percentile ) 1290.46
Mean Distribution
Standard Deviation 2.4806
95.00% Confidence Intervall ( 16111.41 - 16121.13 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2276
0.1 Scale Factor Error with Delta=300 1314
0.05 Scale Factor Error with Delta=300 5253
0.01 Scale Factor Error with Delta=300 131315
Priority Target DPS
Sample Data No_Talent Priority Target Damage Per Second
Count 24999
Mean 16116.27
Minimum 14763.76
Maximum 17798.26
Spread ( max - min ) 3034.50
Range [ ( max - min ) / 2 * 100% ] 9.41%
Standard Deviation 392.2058
5th Percentile 15529.87
95th Percentile 16820.33
( 95th Percentile - 5th Percentile ) 1290.46
Mean Distribution
Standard Deviation 2.4806
95.00% Confidence Intervall ( 16111.41 - 16121.13 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2276
0.1 Scale Factor Error with Delta=300 1314
0.05 Scale Factor Error with Delta=300 5253
0.01 Scale Factor Error with Delta=300 131315
DPS(e)
Sample Data No_Talent Damage Per Second (Effective)
Count 24999
Mean 16116.27
Minimum 14763.76
Maximum 17798.26
Spread ( max - min ) 3034.50
Range [ ( max - min ) / 2 * 100% ] 9.41%
Damage
Sample Data No_Talent Damage
Count 24999
Mean 3907628.39
Minimum 3028969.07
Maximum 4821140.45
Spread ( max - min ) 1792171.38
Range [ ( max - min ) / 2 * 100% ] 22.93%
DTPS
Sample Data No_Talent Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data No_Talent Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data No_Talent Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data No_Talent Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data No_Talent Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data No_Talent Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data No_TalentTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data No_Talent Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 seed_of_corruption,if=spell_targets.seed_of_corruption_aoe>=3
8 0.00 haunt
9 0.00 shadow_bolt,if=!talent.haunt.enabled&spell_targets.seed_of_corruption_aoe<3
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=use_seed,value=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up|talent.siphon_life.enabled&spell_targets.seed_of_corruption>=5+raid_event.invulnerable.up|spell_targets.seed_of_corruption>=8+raid_event.invulnerable.up
0.00 variable,name=padding,op=set,value=action.shadow_bolt.execute_time*azerite.cascading_calamity.enabled
0.00 variable,name=padding,op=reset,value=gcd,if=azerite.cascading_calamity.enabled&(talent.drain_soul.enabled|talent.deathbolt.enabled&cooldown.deathbolt.remains<=gcd)
0.00 variable,name=maintain_se,value=spell_targets.seed_of_corruption_aoe<=1+talent.writhe_in_agony.enabled+talent.absolute_corruption.enabled*2+(talent.writhe_in_agony.enabled&talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>2)+(talent.siphon_life.enabled&!talent.creeping_death.enabled&!talent.drain_soul.enabled)+raid_event.invulnerable.up
A 0.00 call_action_list,name=cooldowns
0.00 drain_soul,interrupt_global=1,chain=1,cycle_targets=1,if=target.time_to_die<=gcd&soul_shard<5
B 17.51 haunt,if=spell_targets.seed_of_corruption_aoe<=2+raid_event.invulnerable.up
C 2.00 summon_darkglare,if=dot.agony.ticking&dot.corruption.ticking&(buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up)
0.00 deathbolt,if=cooldown.summon_darkglare.remains&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up
D 2.45 agony,target_if=min:dot.agony.remains,if=remains<=gcd+action.shadow_bolt.execute_time&target.time_to_die>8
E 0.21 unstable_affliction,target_if=!contagion&target.time_to_die<=8
0.00 drain_soul,target_if=min:debuff.shadow_embrace.remains,cancel_if=ticks_remain<5,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=gcd*2
0.00 shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=execute_time*2+travel_time&!action.shadow_bolt.in_flight
F 5.73 phantom_singularity,target_if=max:target.time_to_die,if=time>35&(cooldown.summon_darkglare.remains>=45|cooldown.summon_darkglare.remains<8)&target.time_to_die>16*spell_haste
0.00 vile_taint,target_if=max:target.time_to_die,if=time>15&target.time_to_die>=10
G 0.09 unstable_affliction,target_if=min:contagion,if=!variable.use_seed&soul_shard=5
0.00 seed_of_corruption,if=variable.use_seed&soul_shard=5
H 0.00 call_action_list,name=dots
I 1.00 phantom_singularity,if=time<=35
0.00 vile_taint,if=time<15
J 2.43 dark_soul,if=cooldown.summon_darkglare.remains<10&dot.phantom_singularity.remains|target.time_to_die<20+gcd|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up
0.00 berserking
K 0.00 call_action_list,name=spenders
L 0.00 call_action_list,name=fillers
actions.cooldowns
# count action,conditions
M 1.00 potion,if=(talent.dark_soul_misery.enabled&cooldown.summon_darkglare.up&cooldown.dark_soul.up)|cooldown.summon_darkglare.up|target.time_to_die<30
N 3.61 use_items,if=!cooldown.summon_darkglare.up,if=cooldown.summon_darkglare.remains>70|time_to_die<20|((buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains)&!cooldown.summon_darkglare.remains)
0.00 fireblood,if=!cooldown.summon_darkglare.up
0.00 blood_fury,if=!cooldown.summon_darkglare.up
actions.dots
# count action,conditions
0.00 seed_of_corruption,if=dot.corruption.remains<=action.seed_of_corruption.cast_time+time_to_shard+4.2*(1-talent.creeping_death.enabled*0.15)&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&!dot.seed_of_corruption.remains&!action.seed_of_corruption.in_flight
0.00 agony,target_if=min:remains,if=talent.creeping_death.enabled&active_dot.agony<6&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
O 13.53 agony,target_if=min:remains,if=!talent.creeping_death.enabled&active_dot.agony<8&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
P 18.88 siphon_life,target_if=min:remains,if=(active_dot.siphon_life<8-talent.creeping_death.enabled-spell_targets.sow_the_seeds_aoe)&target.time_to_die>10&refreshable&(!remains&spell_targets.seed_of_corruption_aoe=1|cooldown.summon_darkglare.remains>soul_shard*action.unstable_affliction.execute_time)
Q 20.10 corruption,cycle_targets=1,if=spell_targets.seed_of_corruption_aoe<3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)&target.time_to_die>10
actions.fillers
# count action,conditions
R 13.10 unstable_affliction,line_cd=15,if=cooldown.deathbolt.remains<=gcd*2&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains>20
S 0.00 call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&(dot.agony.remains<dot.agony.duration*0.75|dot.corruption.remains<dot.corruption.duration*0.75|dot.siphon_life.remains<dot.siphon_life.duration*0.75)&cooldown.deathbolt.remains<=action.agony.gcd*4&cooldown.summon_darkglare.remains>20
T 0.00 call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains<=soul_shard*action.agony.gcd+action.agony.gcd*3&(dot.agony.remains<dot.agony.duration*1|dot.corruption.remains<dot.corruption.duration*1|dot.siphon_life.remains<dot.siphon_life.duration*1)
0.00 deathbolt,if=cooldown.summon_darkglare.remains>=30+gcd|cooldown.summon_darkglare.remains>140
0.00 shadow_bolt,if=buff.movement.up&buff.nightfall.remains
0.00 agony,if=buff.movement.up&!(talent.siphon_life.enabled&(prev_gcd.1.agony&prev_gcd.2.agony&prev_gcd.3.agony)|prev_gcd.1.agony)
0.00 siphon_life,if=buff.movement.up&!(prev_gcd.1.siphon_life&prev_gcd.2.siphon_life&prev_gcd.3.siphon_life)
0.00 corruption,if=buff.movement.up&!prev_gcd.1.corruption&!talent.absolute_corruption.enabled
0.00 drain_life,if=(buff.inevitable_demise.stack>=85-(spell_targets.seed_of_corruption_aoe-raid_event.invulnerable.up>2)*20&(cooldown.deathbolt.remains>execute_time|!talent.deathbolt.enabled)&(cooldown.phantom_singularity.remains>execute_time|!talent.phantom_singularity.enabled)&(cooldown.dark_soul.remains>execute_time|!talent.dark_soul_misery.enabled)&(cooldown.vile_taint.remains>execute_time|!talent.vile_taint.enabled)&cooldown.summon_darkglare.remains>execute_time+10|buff.inevitable_demise.stack>30&target.time_to_die<=10)
0.00 haunt
0.00 drain_soul,interrupt_global=1,chain=1,interrupt=1,cycle_targets=1,if=target.time_to_die<=gcd
0.00 drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains
0.00 drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se
0.00 drain_soul,interrupt_global=1,chain=1,interrupt=1
0.00 shadow_bolt,cycle_targets=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains&!action.shadow_bolt.in_flight
0.00 shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se
U 100.84 shadow_bolt
actions.spenders
# count action,conditions
V 8.45 unstable_affliction,if=cooldown.summon_darkglare.remains<=soul_shard*execute_time&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=soul_shard*execute_time)
W 0.00 call_action_list,name=fillers,if=(cooldown.summon_darkglare.remains<time_to_shard*(6-soul_shard)|cooldown.summon_darkglare.up)&time_to_die>cooldown.summon_darkglare.remains
0.00 seed_of_corruption,if=variable.use_seed
X 1.04 unstable_affliction,if=!variable.use_seed&!prev_gcd.1.summon_darkglare&(talent.deathbolt.enabled&cooldown.deathbolt.remains<=execute_time&!azerite.cascading_calamity.enabled|(soul_shard>=5&spell_targets.seed_of_corruption_aoe<2|soul_shard>=2&spell_targets.seed_of_corruption_aoe>=2)&target.time_to_die>4+execute_time&spell_targets.seed_of_corruption_aoe=1|target.time_to_die<=8+execute_time*soul_shard)
Y 15.38 unstable_affliction,if=!variable.use_seed&contagion<=cast_time+variable.padding
0.00 unstable_affliction,cycle_targets=1,if=!variable.use_seed&(!talent.deathbolt.enabled|cooldown.deathbolt.remains>time_to_shard|soul_shard>1)&(!talent.vile_taint.enabled|soul_shard>1)&contagion<=cast_time+variable.padding&(!azerite.cascading_calamity.enabled|buff.cascading_calamity.remains>time_to_shard)

Sample Sequence

012368DPQIJVVVVNCUURUUUBUUUUPOQUUYURUUUBUUPQYUOUURUUBFPQYUUORUQUBPYUUUUOQYRPBUUUYUQOUFPYNBRUUQUUYOPUBRUQUUUPUOYBQUURUPFUUUOBQURUPUUQUUBOUUPUUQUUUBGVDFJMVPVQVVNCUUBURUUUUUOPQYUBRUUUUPQOYUBFUUQPYUUOUBUYQPUUUYUOBQUPYUUUUFYOBQPNUUUUEUUUB

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask No_Talent 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food No_Talent 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation No_Talent 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_succubus Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 8 haunt Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 default D agony Fluffy_Pillow 98000.0/100000: 98% mana | 3.0/5: 60% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.296 dots P siphon_life Fluffy_Pillow 98296.0/100000: 98% mana | 3.0/5: 60% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:02.295 dots Q corruption Fluffy_Pillow 99295.0/100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:03.293 default I phantom_singularity Fluffy_Pillow 99293.0/100000: 99% mana | 4.0/5: 80% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:04.293 default J dark_soul Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:05.291 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, dark_soul, archive_of_the_titans(2), battle_potion_of_intellect
0:06.092 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, active_uas, dark_soul, archive_of_the_titans(2), battle_potion_of_intellect
0:06.892 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), dark_soul, archive_of_the_titans(2), battle_potion_of_intellect
0:07.693 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(3), dark_soul, archive_of_the_titans(2), battle_potion_of_intellect
0:08.492 cooldowns N use_items Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(4), dark_soul, archive_of_the_titans(2), battle_potion_of_intellect
0:08.492 default C summon_darkglare Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(4), dark_soul, archive_of_the_titans(2), battle_potion_of_intellect, kindled_soul(100)
0:09.291 fillers U shadow_bolt Fluffy_Pillow 98799.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, archive_of_the_titans(2), battle_potion_of_intellect, kindled_soul(100)
0:10.353 fillers U shadow_bolt Fluffy_Pillow 97861.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(95)
0:11.417 fillers R unstable_affliction Fluffy_Pillow 96925.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation, archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(90)
0:12.217 fillers U shadow_bolt Fluffy_Pillow 97725.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation, archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(85)
0:13.283 fillers U shadow_bolt Fluffy_Pillow 96791.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(3), archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(80)
0:14.348 fillers U shadow_bolt Fluffy_Pillow 95856.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(3), archive_of_the_titans(3), battle_potion_of_intellect, kindled_soul(75)
0:15.414 default B haunt Fluffy_Pillow 94922.0/100000: 95% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(3), elemental_whirl_crit, archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(70)
0:16.214 fillers U shadow_bolt Fluffy_Pillow 93722.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(3), elemental_whirl_crit, overwhelming_power(25), archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(65)
0:17.199 fillers U shadow_bolt Fluffy_Pillow 92707.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(4), elemental_whirl_crit, overwhelming_power(24), archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(60)
0:18.188 fillers U shadow_bolt Fluffy_Pillow 91696.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(4), elemental_whirl_crit, overwhelming_power(23), archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(55)
0:19.180 fillers U shadow_bolt Fluffy_Pillow 90688.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(4), elemental_whirl_crit, overwhelming_power(22), archive_of_the_titans(4), battle_potion_of_intellect, kindled_soul(50)
0:20.176 dots P siphon_life Fluffy_Pillow 89684.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(5), dark_soul, masterful_navigation(4), elemental_whirl_crit, overwhelming_power(21), archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(45)
0:20.932 dots O agony Fluffy_Pillow 90440.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation(4), elemental_whirl_crit, overwhelming_power(21), archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(40)
0:21.686 dots Q corruption Fluffy_Pillow 90194.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(4), dark_soul, masterful_navigation(4), elemental_whirl_crit, overwhelming_power(20), archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(35)
0:22.442 fillers U shadow_bolt Fluffy_Pillow 89950.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(3), dark_soul, masterful_navigation(4), elemental_whirl_crit, overwhelming_power(19), archive_of_the_titans(5), battle_potion_of_intellect, kindled_soul(35)
0:23.444 fillers U shadow_bolt Fluffy_Pillow 88952.0/100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), dark_soul, masterful_navigation(4), elemental_whirl_crit, overwhelming_power(18), archive_of_the_titans(5), kindled_soul(30)
0:24.452 spenders Y unstable_affliction Fluffy_Pillow 87960.0/100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, masterful_navigation(4), elemental_whirl_crit, overwhelming_power(17), archive_of_the_titans(5), kindled_soul(25)
0:25.398 fillers U shadow_bolt Fluffy_Pillow 88906.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(4), overwhelming_power(16), archive_of_the_titans(6), kindled_soul(20)
0:26.662 fillers R unstable_affliction Fluffy_Pillow 88170.0/100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(4), overwhelming_power(15), archive_of_the_titans(6), kindled_soul(10)
0:27.615 fillers U shadow_bolt Fluffy_Pillow 89123.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), masterful_navigation(4), overwhelming_power(14), archive_of_the_titans(6), kindled_soul(5)
0:28.888 fillers U shadow_bolt Fluffy_Pillow 88396.0/100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), masterful_navigation(4), overwhelming_power(13), archive_of_the_titans(6)
0:30.164 fillers U shadow_bolt Fluffy_Pillow 87672.0/100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), masterful_navigation(4), overwhelming_power(11), archive_of_the_titans(7)
0:31.448 default B haunt Fluffy_Pillow 86956.0/100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), masterful_navigation(4), overwhelming_power(10), archive_of_the_titans(7)
0:32.416 fillers U shadow_bolt Fluffy_Pillow 85924.0/100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), masterful_navigation(4), overwhelming_power(9), archive_of_the_titans(7)
0:33.708 fillers U shadow_bolt Fluffy_Pillow 85216.0/100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation(4), overwhelming_power(8), archive_of_the_titans(7)
0:35.006 dots P siphon_life Fluffy_Pillow 84514.0/100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation_final, overwhelming_power(6), archive_of_the_titans(8)
0:35.986 dots Q corruption Fluffy_Pillow 85494.0/100000: 85% mana | 2.0/5: 40% soul_shard bloodlust, masterful_navigation_final, overwhelming_power(6), archive_of_the_titans(8)
0:36.967 spenders Y unstable_affliction Fluffy_Pillow 85475.0/100000: 85% mana | 2.0/5: 40% soul_shard bloodlust, masterful_navigation_final, overwhelming_power(5), archive_of_the_titans(8)
0:37.949 fillers U shadow_bolt Fluffy_Pillow 86457.0/100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation_final, overwhelming_power(4), archive_of_the_titans(8)
0:39.260 dots O agony Fluffy_Pillow 85768.0/100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation_final, overwhelming_power(2), archive_of_the_titans(8)
0:40.252 fillers U shadow_bolt Fluffy_Pillow 85760.0/100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, active_uas, masterful_navigation_final, overwhelming_power, archive_of_the_titans(9)
0:41.578 fillers U shadow_bolt Fluffy_Pillow 85086.0/100000: 85% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(9)
0:43.305 fillers R unstable_affliction Fluffy_Pillow 84813.0/100000: 85% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(9)
0:44.602 fillers U shadow_bolt Fluffy_Pillow 86110.0/100000: 86% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation_final, archive_of_the_titans(9)
0:46.327 fillers U shadow_bolt Fluffy_Pillow 85835.0/100000: 86% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(10)
0:48.053 default B haunt Fluffy_Pillow 85561.0/100000: 86% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(10)
0:49.349 default F phantom_singularity Fluffy_Pillow 84857.0/100000: 85% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(10)
0:50.647 dots P siphon_life Fluffy_Pillow 86155.0/100000: 86% mana | 2.0/5: 40% soul_shard active_uas, archive_of_the_titans(11)
0:51.944 dots Q corruption Fluffy_Pillow 87452.0/100000: 87% mana | 2.0/5: 40% soul_shard active_uas, archive_of_the_titans(11)
0:53.240 spenders Y unstable_affliction Fluffy_Pillow 87748.0/100000: 88% mana | 2.0/5: 40% soul_shard archive_of_the_titans(11)
0:54.537 fillers U shadow_bolt Fluffy_Pillow 89045.0/100000: 89% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(11)
0:56.265 fillers U shadow_bolt Fluffy_Pillow 88773.0/100000: 89% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(12)
0:57.993 dots O agony Fluffy_Pillow 88501.0/100000: 89% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(12)
0:59.289 fillers R unstable_affliction Fluffy_Pillow 88797.0/100000: 89% mana | 2.0/5: 40% soul_shard active_uas, archive_of_the_titans(12)
1:00.585 fillers U shadow_bolt Fluffy_Pillow 90093.0/100000: 90% mana | 1.0/5: 20% soul_shard active_uas(2), archive_of_the_titans(13)
1:02.314 dots Q corruption Fluffy_Pillow 89822.0/100000: 90% mana | 1.0/5: 20% soul_shard active_uas(2), archive_of_the_titans(13)
1:03.612 fillers U shadow_bolt Fluffy_Pillow 90120.0/100000: 90% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, archive_of_the_titans(13)
1:05.340 default B haunt Fluffy_Pillow 89848.0/100000: 90% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, archive_of_the_titans(14)
1:06.636 dots P siphon_life Fluffy_Pillow 89144.0/100000: 89% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(14)
1:07.891 spenders Y unstable_affliction Fluffy_Pillow 90399.0/100000: 90% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(14)
1:09.147 fillers U shadow_bolt Fluffy_Pillow 91655.0/100000: 92% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(14)
1:10.818 fillers U shadow_bolt Fluffy_Pillow 91326.0/100000: 91% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(15)
1:12.488 fillers U shadow_bolt Fluffy_Pillow 90996.0/100000: 91% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(15)
1:14.157 fillers U shadow_bolt Fluffy_Pillow 90665.0/100000: 91% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(15)
1:15.827 dots O agony Fluffy_Pillow 90335.0/100000: 90% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation, archive_of_the_titans(16)
1:17.122 dots Q corruption Fluffy_Pillow 90630.0/100000: 91% mana | 2.0/5: 40% soul_shard active_uas, masterful_navigation, archive_of_the_titans(16)
1:18.419 spenders Y unstable_affliction Fluffy_Pillow 90927.0/100000: 91% mana | 2.0/5: 40% soul_shard masterful_navigation, archive_of_the_titans(16)
1:19.716 fillers R unstable_affliction Fluffy_Pillow 92224.0/100000: 92% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, archive_of_the_titans(16)
1:21.012 dots P siphon_life Fluffy_Pillow 93520.0/100000: 94% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation, archive_of_the_titans(17)
1:22.310 default B haunt Fluffy_Pillow 94818.0/100000: 95% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation, archive_of_the_titans(17)
1:23.607 fillers U shadow_bolt Fluffy_Pillow 94115.0/100000: 94% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(2), archive_of_the_titans(17)
1:25.333 fillers U shadow_bolt Fluffy_Pillow 93841.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation(2), archive_of_the_titans(18)
1:27.062 fillers U shadow_bolt Fluffy_Pillow 93570.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation(3), overwhelming_power(23), archive_of_the_titans(18)
1:28.672 spenders Y unstable_affliction Fluffy_Pillow 93180.0/100000: 93% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), overwhelming_power(22), archive_of_the_titans(18)
1:29.884 fillers U shadow_bolt Fluffy_Pillow 94392.0/100000: 94% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), overwhelming_power(21), archive_of_the_titans(18)
1:31.502 dots Q corruption Fluffy_Pillow 94010.0/100000: 94% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), elemental_whirl_haste, overwhelming_power(19), archive_of_the_titans(19)
1:32.687 dots O agony Fluffy_Pillow 94195.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_haste, overwhelming_power(18), archive_of_the_titans(19)
1:33.875 fillers U shadow_bolt Fluffy_Pillow 94383.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_haste, overwhelming_power(17), archive_of_the_titans(19)
1:35.462 default F phantom_singularity Fluffy_Pillow 93970.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_haste, overwhelming_power(15), archive_of_the_titans(20)
1:36.660 dots P siphon_life Fluffy_Pillow 95168.0/100000: 95% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_haste, overwhelming_power(14), archive_of_the_titans(20)
1:37.862 spenders Y unstable_affliction Fluffy_Pillow 96370.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_haste, overwhelming_power(13), archive_of_the_titans(20)
1:39.066 cooldowns N use_items Fluffy_Pillow 97574.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_haste, overwhelming_power(11), archive_of_the_titans(20)
1:39.066 default B haunt Fluffy_Pillow 97574.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_haste, overwhelming_power(11), archive_of_the_titans(20), kindled_soul(100)
1:40.280 fillers R unstable_affliction Fluffy_Pillow 96788.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_haste, overwhelming_power(10), archive_of_the_titans(20), kindled_soul(95)
1:41.497 fillers U shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(4), overwhelming_power(9), archive_of_the_titans(20), kindled_soul(90)
1:43.175 fillers U shadow_bolt Fluffy_Pillow 97683.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(4), overwhelming_power(7), archive_of_the_titans(20), kindled_soul(80)
1:44.863 dots Q corruption Fluffy_Pillow 97371.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation_final, overwhelming_power(6), archive_of_the_titans(20), kindled_soul(75)
1:46.136 fillers U shadow_bolt Fluffy_Pillow 97644.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas(2), masterful_navigation_final, overwhelming_power(4), archive_of_the_titans(20), kindled_soul(65)
1:47.841 fillers U shadow_bolt Fluffy_Pillow 97349.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, overwhelming_power(3), archive_of_the_titans(20), kindled_soul(60)
1:49.550 spenders Y unstable_affliction Fluffy_Pillow 97058.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation_final, overwhelming_power, archive_of_the_titans(20), kindled_soul(50)
1:50.843 dots O agony Fluffy_Pillow 98351.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20), kindled_soul(45)
1:52.139 dots P siphon_life Fluffy_Pillow 98647.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20), kindled_soul(35)
1:53.435 fillers U shadow_bolt Fluffy_Pillow 99943.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20), kindled_soul(30)
1:55.162 default B haunt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, archive_of_the_titans(20), kindled_soul(20)
1:56.570 fillers R unstable_affliction Fluffy_Pillow 97412.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, archive_of_the_titans(20), kindled_soul(15)
1:57.868 fillers U shadow_bolt Fluffy_Pillow 98710.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), archive_of_the_titans(20), kindled_soul(10)
1:59.595 dots Q corruption Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, archive_of_the_titans(20)
2:00.890 fillers U shadow_bolt Fluffy_Pillow 98299.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, archive_of_the_titans(20)
2:02.617 fillers U shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, archive_of_the_titans(20)
2:04.342 fillers U shadow_bolt Fluffy_Pillow 97729.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, archive_of_the_titans(20)
2:06.071 dots P siphon_life Fluffy_Pillow 97458.0/100000: 97% mana | 0.0/5: 0% soul_shard masterful_navigation, archive_of_the_titans(20)
2:07.367 fillers U shadow_bolt Fluffy_Pillow 98754.0/100000: 99% mana | 0.0/5: 0% soul_shard masterful_navigation, archive_of_the_titans(20)
2:09.094 dots O agony Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard masterful_navigation(2), archive_of_the_titans(20)
2:10.391 spenders Y unstable_affliction Fluffy_Pillow 98301.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(2), archive_of_the_titans(20)
2:11.687 default B haunt Fluffy_Pillow 99597.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
2:12.887 dots Q corruption Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), overwhelming_power(24), archive_of_the_titans(20)
2:14.091 fillers U shadow_bolt Fluffy_Pillow 98208.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), overwhelming_power(22), archive_of_the_titans(20)
2:15.706 fillers U shadow_bolt Fluffy_Pillow 97823.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), elemental_whirl_crit, overwhelming_power(21), archive_of_the_titans(20)
2:17.322 fillers R unstable_affliction Fluffy_Pillow 97439.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, overwhelming_power(19), archive_of_the_titans(20)
2:18.544 fillers U shadow_bolt Fluffy_Pillow 98661.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, overwhelming_power(18), archive_of_the_titans(20)
2:20.177 dots P siphon_life Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, overwhelming_power(16), archive_of_the_titans(20)
2:21.411 default F phantom_singularity Fluffy_Pillow 99238.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), elemental_whirl_crit, elemental_whirl_mastery, overwhelming_power(15), archive_of_the_titans(20)
2:22.647 fillers U shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), elemental_whirl_crit, elemental_whirl_mastery, overwhelming_power(14), archive_of_the_titans(20)
2:24.300 fillers U shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), elemental_whirl_mastery, overwhelming_power(12), archive_of_the_titans(20)
2:25.963 fillers U shadow_bolt Fluffy_Pillow 97667.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), elemental_whirl_mastery, overwhelming_power(11), archive_of_the_titans(20)
2:27.631 dots O agony Fluffy_Pillow 97335.0/100000: 97% mana | 0.0/5: 0% soul_shard masterful_navigation(4), elemental_whirl_mastery, overwhelming_power(9), archive_of_the_titans(20)
2:28.893 default B haunt Fluffy_Pillow 97597.0/100000: 98% mana | 0.0/5: 0% soul_shard masterful_navigation(4), elemental_whirl_mastery, overwhelming_power(8), archive_of_the_titans(20)
2:30.157 dots Q corruption Fluffy_Pillow 96861.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation(4), elemental_whirl_mastery, overwhelming_power(6), archive_of_the_titans(20)
2:31.429 fillers U shadow_bolt Fluffy_Pillow 97133.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation(4), elemental_whirl_mastery, overwhelming_power(5), archive_of_the_titans(20)
2:33.127 fillers R unstable_affliction Fluffy_Pillow 96831.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation(4), elemental_whirl_mastery, overwhelming_power(3), archive_of_the_titans(20)
2:34.413 fillers U shadow_bolt Fluffy_Pillow 98117.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), elemental_whirl_mastery, overwhelming_power(2), archive_of_the_titans(20)
2:36.130 dots P siphon_life Fluffy_Pillow 97834.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
2:37.426 fillers U shadow_bolt Fluffy_Pillow 99130.0/100000: 99% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
2:39.154 fillers U shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
2:40.882 dots Q corruption Fluffy_Pillow 97733.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
2:42.087 fillers U shadow_bolt Fluffy_Pillow 97938.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
2:43.701 fillers U shadow_bolt Fluffy_Pillow 97552.0/100000: 98% mana | 2.0/5: 40% soul_shard masterful_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
2:45.318 default B haunt Fluffy_Pillow 97169.0/100000: 97% mana | 2.0/5: 40% soul_shard masterful_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
2:46.540 dots O agony Fluffy_Pillow 96391.0/100000: 96% mana | 2.0/5: 40% soul_shard overwhelming_power(18), archive_of_the_titans(20)
2:47.766 fillers U shadow_bolt Fluffy_Pillow 96617.0/100000: 97% mana | 2.0/5: 40% soul_shard overwhelming_power(17), archive_of_the_titans(20)
2:49.404 fillers U shadow_bolt Fluffy_Pillow 96255.0/100000: 96% mana | 2.0/5: 40% soul_shard overwhelming_power(15), archive_of_the_titans(20)
2:51.051 dots P siphon_life Fluffy_Pillow 95902.0/100000: 96% mana | 2.0/5: 40% soul_shard masterful_navigation, overwhelming_power(13), archive_of_the_titans(20)
2:52.295 fillers U shadow_bolt Fluffy_Pillow 97146.0/100000: 97% mana | 3.0/5: 60% soul_shard masterful_navigation, overwhelming_power(12), archive_of_the_titans(20)
2:53.957 fillers U shadow_bolt Fluffy_Pillow 96808.0/100000: 97% mana | 3.0/5: 60% soul_shard masterful_navigation, overwhelming_power(11), archive_of_the_titans(20)
2:55.625 dots Q corruption Fluffy_Pillow 96476.0/100000: 96% mana | 3.0/5: 60% soul_shard masterful_navigation(2), overwhelming_power(9), archive_of_the_titans(20)
2:56.885 fillers U shadow_bolt Fluffy_Pillow 96736.0/100000: 97% mana | 3.0/5: 60% soul_shard masterful_navigation(2), overwhelming_power(8), archive_of_the_titans(20)
2:58.570 fillers U shadow_bolt Fluffy_Pillow 96421.0/100000: 96% mana | 4.0/5: 80% soul_shard masterful_navigation(2), overwhelming_power(6), archive_of_the_titans(20)
3:00.263 fillers U shadow_bolt Fluffy_Pillow 96114.0/100000: 96% mana | 4.0/5: 80% soul_shard masterful_navigation(2), overwhelming_power(4), archive_of_the_titans(20)
3:01.969 default B haunt Fluffy_Pillow 95820.0/100000: 96% mana | 4.0/5: 80% soul_shard masterful_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
3:03.168 default G unstable_affliction Fluffy_Pillow 95019.0/100000: 95% mana | 5.0/5: 100% soul_shard masterful_navigation(2), overwhelming_power(23), archive_of_the_titans(20)
3:04.376 spenders V unstable_affliction Fluffy_Pillow 96227.0/100000: 96% mana | 4.0/5: 80% soul_shard active_uas, masterful_navigation(2), overwhelming_power(22), archive_of_the_titans(20)
3:05.587 default D agony Fluffy_Pillow 97438.0/100000: 97% mana | 3.0/5: 60% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
3:06.802 default F phantom_singularity Fluffy_Pillow 97653.0/100000: 98% mana | 3.0/5: 60% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
3:08.022 default J dark_soul Fluffy_Pillow 98873.0/100000: 99% mana | 3.0/5: 60% soul_shard active_uas(2), masterful_navigation(2), overwhelming_power(18), archive_of_the_titans(20)
3:09.248 cooldowns M potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard active_uas(2), dark_soul, masterful_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
3:09.248 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard active_uas(2), dark_soul, masterful_navigation(2), overwhelming_power(17), archive_of_the_titans(20), battle_potion_of_intellect
3:10.233 dots P siphon_life Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard active_uas(3), dark_soul, masterful_navigation(2), overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
3:11.223 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard active_uas(3), dark_soul, masterful_navigation(2), overwhelming_power(15), archive_of_the_titans(20), battle_potion_of_intellect
3:12.213 dots Q corruption Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard active_uas(4), dark_soul, masterful_navigation(3), overwhelming_power(14), archive_of_the_titans(20), battle_potion_of_intellect
3:13.207 spenders V unstable_affliction Fluffy_Pillow 99994.0/100000: 100% mana | 1.0/5: 20% soul_shard active_uas(3), dark_soul, masterful_navigation(3), overwhelming_power(13), archive_of_the_titans(20), battle_potion_of_intellect
3:14.205 spenders V unstable_affliction Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard active_uas(3), dark_soul, masterful_navigation(3), overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect
3:15.204 cooldowns N use_items Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(4), dark_soul, masterful_navigation(3), overwhelming_power(11), archive_of_the_titans(20), battle_potion_of_intellect
3:15.204 default C summon_darkglare Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas(4), dark_soul, masterful_navigation(3), overwhelming_power(11), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(100)
3:16.205 fillers U shadow_bolt Fluffy_Pillow 99001.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas(4), dark_soul, masterful_navigation(3), overwhelming_power(10), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(95)
3:17.543 fillers U shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas(4), dark_soul, masterful_navigation(4), overwhelming_power(9), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(90)
3:18.888 default B haunt Fluffy_Pillow 97348.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas(4), dark_soul, masterful_navigation(4), overwhelming_power(8), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(85)
3:19.898 fillers U shadow_bolt Fluffy_Pillow 96358.0/100000: 96% mana | 0.0/5: 0% soul_shard active_uas(4), dark_soul, masterful_navigation_final, overwhelming_power(7), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(80)
3:21.250 fillers R unstable_affliction Fluffy_Pillow 95710.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas(4), dark_soul, masterful_navigation_final, overwhelming_power(5), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(70)
3:22.271 fillers U shadow_bolt Fluffy_Pillow 96731.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation_final, overwhelming_power(4), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(65)
3:23.637 fillers U shadow_bolt Fluffy_Pillow 96097.0/100000: 96% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation_final, overwhelming_power(3), archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(60)
3:25.007 fillers U shadow_bolt Fluffy_Pillow 95467.0/100000: 95% mana | 0.0/5: 0% soul_shard active_uas(5), dark_soul, masterful_navigation_final, overwhelming_power, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(55)
3:26.386 fillers U shadow_bolt Fluffy_Pillow 94846.0/100000: 95% mana | 0.0/5: 0% soul_shard active_uas(4), dark_soul, masterful_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(45)
3:27.768 fillers U shadow_bolt Fluffy_Pillow 94228.0/100000: 94% mana | 0.0/5: 0% soul_shard active_uas(4), dark_soul, masterful_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(40)
3:29.151 dots O agony Fluffy_Pillow 93611.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas(3), masterful_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(35)
3:30.447 dots P siphon_life Fluffy_Pillow 93907.0/100000: 94% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(25)
3:31.743 dots Q corruption Fluffy_Pillow 95203.0/100000: 95% mana | 1.0/5: 20% soul_shard masterful_navigation, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(20)
3:33.041 spenders Y unstable_affliction Fluffy_Pillow 95501.0/100000: 96% mana | 1.0/5: 20% soul_shard masterful_navigation, archive_of_the_titans(20), battle_potion_of_intellect, kindled_soul(15)
3:34.340 fillers U shadow_bolt Fluffy_Pillow 96800.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(20), kindled_soul(5)
3:36.011 default B haunt Fluffy_Pillow 96471.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(20)
3:37.265 fillers R unstable_affliction Fluffy_Pillow 95725.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation, elemental_whirl_haste, archive_of_the_titans(20)
3:38.521 fillers U shadow_bolt Fluffy_Pillow 96981.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation, elemental_whirl_haste, archive_of_the_titans(20)
3:40.193 fillers U shadow_bolt Fluffy_Pillow 96653.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation, elemental_whirl_haste, archive_of_the_titans(20)
3:41.866 fillers U shadow_bolt Fluffy_Pillow 96326.0/100000: 96% mana | 0.0/5: 0% soul_shard active_uas(2), masterful_navigation(3), elemental_whirl_haste, archive_of_the_titans(20)
3:43.537 fillers U shadow_bolt Fluffy_Pillow 95997.0/100000: 96% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), elemental_whirl_haste, archive_of_the_titans(20)
3:45.206 dots P siphon_life Fluffy_Pillow 95666.0/100000: 96% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
3:46.502 dots Q corruption Fluffy_Pillow 96962.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
3:47.800 dots O agony Fluffy_Pillow 97260.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
3:49.095 spenders Y unstable_affliction Fluffy_Pillow 97555.0/100000: 98% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
3:50.391 fillers U shadow_bolt Fluffy_Pillow 98851.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
3:52.119 default B haunt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
3:53.558 default F phantom_singularity Fluffy_Pillow 97444.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
3:54.855 fillers U shadow_bolt Fluffy_Pillow 98741.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
3:56.584 fillers U shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
3:58.311 dots Q corruption Fluffy_Pillow 97733.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), archive_of_the_titans(20)
3:59.608 dots P siphon_life Fluffy_Pillow 98030.0/100000: 98% mana | 0.0/5: 0% soul_shard masterful_navigation(3), archive_of_the_titans(20)
4:00.904 spenders Y unstable_affliction Fluffy_Pillow 99326.0/100000: 99% mana | 1.0/5: 20% soul_shard masterful_navigation(3), archive_of_the_titans(20)
4:02.200 fillers U shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
4:03.927 fillers U shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
4:05.654 dots O agony Fluffy_Pillow 97731.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
4:06.951 fillers U shadow_bolt Fluffy_Pillow 98028.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
4:08.681 default B haunt Fluffy_Pillow 97758.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
4:09.977 fillers U shadow_bolt Fluffy_Pillow 97054.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
4:11.703 spenders Y unstable_affliction Fluffy_Pillow 96780.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation(4), archive_of_the_titans(20)
4:12.999 dots Q corruption Fluffy_Pillow 98076.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
4:14.293 dots P siphon_life Fluffy_Pillow 98370.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
4:15.588 fillers U shadow_bolt Fluffy_Pillow 99665.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), archive_of_the_titans(20)
4:17.315 fillers U shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), elemental_whirl_crit, archive_of_the_titans(20)
4:19.044 fillers U shadow_bolt Fluffy_Pillow 97733.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(4), elemental_whirl_crit, archive_of_the_titans(20)
4:20.773 spenders Y unstable_affliction Fluffy_Pillow 97462.0/100000: 97% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation(4), elemental_whirl_crit, archive_of_the_titans(20)
4:22.071 fillers U shadow_bolt Fluffy_Pillow 98760.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, elemental_whirl_crit, archive_of_the_titans(20)
4:23.800 dots O agony Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, elemental_whirl_crit, archive_of_the_titans(20)
4:25.097 default B haunt Fluffy_Pillow 98303.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, elemental_whirl_crit, archive_of_the_titans(20)
4:26.393 dots Q corruption Fluffy_Pillow 97599.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:27.690 fillers U shadow_bolt Fluffy_Pillow 97896.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:29.417 dots P siphon_life Fluffy_Pillow 97623.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, masterful_navigation_final, archive_of_the_titans(20)
4:30.714 spenders Y unstable_affliction Fluffy_Pillow 98920.0/100000: 99% mana | 1.0/5: 20% soul_shard masterful_navigation_final, archive_of_the_titans(20)
4:32.013 fillers U shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
4:33.619 fillers U shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(23), archive_of_the_titans(20)
4:35.227 fillers U shadow_bolt Fluffy_Pillow 97614.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(21), archive_of_the_titans(20)
4:36.847 fillers U shadow_bolt Fluffy_Pillow 97234.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(20), archive_of_the_titans(20)
4:38.469 default F phantom_singularity Fluffy_Pillow 96856.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(18), archive_of_the_titans(20)
4:39.785 spenders Y unstable_affliction Fluffy_Pillow 98172.0/100000: 98% mana | 1.0/5: 20% soul_shard active_uas, overwhelming_power(17), archive_of_the_titans(20)
4:41.013 dots O agony Fluffy_Pillow 99400.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(15), archive_of_the_titans(20)
4:42.251 default B haunt Fluffy_Pillow 99638.0/100000: 100% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(14), archive_of_the_titans(20)
4:43.491 dots Q corruption Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(13), archive_of_the_titans(20)
4:44.737 dots P siphon_life Fluffy_Pillow 98249.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(12), archive_of_the_titans(20)
4:45.985 cooldowns N use_items Fluffy_Pillow 99497.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(11), archive_of_the_titans(20)
4:45.985 fillers U shadow_bolt Fluffy_Pillow 99497.0/100000: 99% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(11), archive_of_the_titans(20), kindled_soul(100)
4:47.654 fillers U shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, overwhelming_power(9), archive_of_the_titans(20), kindled_soul(95)
4:49.334 fillers U shadow_bolt Fluffy_Pillow 97685.0/100000: 98% mana | 0.0/5: 0% soul_shard masterful_navigation, overwhelming_power(7), archive_of_the_titans(20), kindled_soul(85)
4:51.024 fillers U shadow_bolt Fluffy_Pillow 97375.0/100000: 97% mana | 0.0/5: 0% soul_shard masterful_navigation, overwhelming_power(5), archive_of_the_titans(20), kindled_soul(75)
4:52.726 default E unstable_affliction Fluffy_Pillow 97077.0/100000: 97% mana | 1.0/5: 20% soul_shard masterful_navigation, overwhelming_power(4), archive_of_the_titans(20), kindled_soul(70)
4:54.006 fillers U shadow_bolt Fluffy_Pillow 98357.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, elemental_whirl_mastery, overwhelming_power(2), archive_of_the_titans(20), kindled_soul(60)
4:55.723 fillers U shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation, elemental_whirl_mastery, overwhelming_power, archive_of_the_titans(20), kindled_soul(55)
4:57.446 fillers U shadow_bolt Fluffy_Pillow 97728.0/100000: 98% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), elemental_whirl_mastery, archive_of_the_titans(20), kindled_soul(45)
4:59.173 default B haunt Fluffy_Pillow 97455.0/100000: 97% mana | 0.0/5: 0% soul_shard active_uas, masterful_navigation(3), elemental_whirl_mastery, archive_of_the_titans(20), kindled_soul(35)

Stats

Level Bonus (120) Race Bonus (goblin) Raid-Buffed Unbuffed Gear Amount
Strength 1467 -3 1524 1464 0
Agility 1467 1 1528 1468 0
Stamina 1001 -1 9025 8205 7205
Intellect 1467 3 8169 7008 5205 (377)
Spirit 0 0 0 0 0
Health 180500 164100 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8169 7008 0
Crit 16.14% 16.14% 802
Haste 16.06% 16.06% 1014
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 62.35% 62.35% 1220
Armor 1165 1165 1165
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Visage of the Ascended Prophet
ilevel: 390, stats: { 155 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Mantle of Contained Corruption
ilevel: 390, stats: { 143 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 190 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 161 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 115 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Ring of the Infinite Void
ilevel: 385, stats: { +312 Sta, +240 Mastery, +191 Crit }, enchant: { +37 Mastery }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Mastery }
Local Trinket1 Balefire Branch
ilevel: 370, stats: { +164 Mastery }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 92 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: masterful_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Nightfall (Affliction Warlock) Drain Soul (Affliction Warlock) Deathbolt (Affliction Warlock)
30 Writhe in Agony (Affliction Warlock) Absolute Corruption (Affliction Warlock) Siphon Life (Affliction Warlock)
45 Demon Skin Burning Rush Dark Pact
60 Sow the Seeds (Affliction Warlock) Phantom Singularity Vile Taint (Affliction Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Shadow Embrace (Affliction Warlock) Haunt (Affliction Warlock) Grimoire of Sacrifice
100 Soul Conduit Creeping Death (Affliction Warlock) Dark Soul: Misery (Affliction Warlock)

Profile

warlock="No_Talent"
source=default
spec=affliction
level=120
race=goblin
role=spell
position=ranged_back
talents=0302023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/seed_of_corruption,if=spell_targets.seed_of_corruption_aoe>=3
actions.precombat+=/haunt
actions.precombat+=/shadow_bolt,if=!talent.haunt.enabled&spell_targets.seed_of_corruption_aoe<3

# Executed every time the actor is available.
actions=variable,name=use_seed,value=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up|talent.siphon_life.enabled&spell_targets.seed_of_corruption>=5+raid_event.invulnerable.up|spell_targets.seed_of_corruption>=8+raid_event.invulnerable.up
actions+=/variable,name=padding,op=set,value=action.shadow_bolt.execute_time*azerite.cascading_calamity.enabled
actions+=/variable,name=padding,op=reset,value=gcd,if=azerite.cascading_calamity.enabled&(talent.drain_soul.enabled|talent.deathbolt.enabled&cooldown.deathbolt.remains<=gcd)
actions+=/variable,name=maintain_se,value=spell_targets.seed_of_corruption_aoe<=1+talent.writhe_in_agony.enabled+talent.absolute_corruption.enabled*2+(talent.writhe_in_agony.enabled&talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption_aoe>2)+(talent.siphon_life.enabled&!talent.creeping_death.enabled&!talent.drain_soul.enabled)+raid_event.invulnerable.up
actions+=/call_action_list,name=cooldowns
actions+=/drain_soul,interrupt_global=1,chain=1,cycle_targets=1,if=target.time_to_die<=gcd&soul_shard<5
actions+=/haunt,if=spell_targets.seed_of_corruption_aoe<=2+raid_event.invulnerable.up
actions+=/summon_darkglare,if=dot.agony.ticking&dot.corruption.ticking&(buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up)
actions+=/deathbolt,if=cooldown.summon_darkglare.remains&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up
actions+=/agony,target_if=min:dot.agony.remains,if=remains<=gcd+action.shadow_bolt.execute_time&target.time_to_die>8
actions+=/unstable_affliction,target_if=!contagion&target.time_to_die<=8
actions+=/drain_soul,target_if=min:debuff.shadow_embrace.remains,cancel_if=ticks_remain<5,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=gcd*2
actions+=/shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se&debuff.shadow_embrace.remains&debuff.shadow_embrace.remains<=execute_time*2+travel_time&!action.shadow_bolt.in_flight
actions+=/phantom_singularity,target_if=max:target.time_to_die,if=time>35&(cooldown.summon_darkglare.remains>=45|cooldown.summon_darkglare.remains<8)&target.time_to_die>16*spell_haste
actions+=/vile_taint,target_if=max:target.time_to_die,if=time>15&target.time_to_die>=10
actions+=/unstable_affliction,target_if=min:contagion,if=!variable.use_seed&soul_shard=5
actions+=/seed_of_corruption,if=variable.use_seed&soul_shard=5
actions+=/call_action_list,name=dots
actions+=/phantom_singularity,if=time<=35
actions+=/vile_taint,if=time<15
actions+=/dark_soul,if=cooldown.summon_darkglare.remains<10&dot.phantom_singularity.remains|target.time_to_die<20+gcd|spell_targets.seed_of_corruption_aoe>1+raid_event.invulnerable.up
actions+=/berserking
actions+=/call_action_list,name=spenders
actions+=/call_action_list,name=fillers

actions.cooldowns=potion,if=(talent.dark_soul_misery.enabled&cooldown.summon_darkglare.up&cooldown.dark_soul.up)|cooldown.summon_darkglare.up|target.time_to_die<30
actions.cooldowns+=/use_items,if=!cooldown.summon_darkglare.up,if=cooldown.summon_darkglare.remains>70|time_to_die<20|((buff.active_uas.stack=5|soul_shard=0)&(!talent.phantom_singularity.enabled|cooldown.phantom_singularity.remains)&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=gcd|!cooldown.deathbolt.remains)&!cooldown.summon_darkglare.remains)
actions.cooldowns+=/fireblood,if=!cooldown.summon_darkglare.up
actions.cooldowns+=/blood_fury,if=!cooldown.summon_darkglare.up

actions.db_refresh=siphon_life,line_cd=15,if=(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.siphon_life.remains%dot.siphon_life.duration)<=(dot.corruption.remains%dot.corruption.duration)&dot.siphon_life.remains<dot.siphon_life.duration*1.3
actions.db_refresh+=/agony,line_cd=15,if=(dot.agony.remains%dot.agony.duration)<=(dot.corruption.remains%dot.corruption.duration)&(dot.agony.remains%dot.agony.duration)<=(dot.siphon_life.remains%dot.siphon_life.duration)&dot.agony.remains<dot.agony.duration*1.3
actions.db_refresh+=/corruption,line_cd=15,if=(dot.corruption.remains%dot.corruption.duration)<=(dot.agony.remains%dot.agony.duration)&(dot.corruption.remains%dot.corruption.duration)<=(dot.siphon_life.remains%dot.siphon_life.duration)&dot.corruption.remains<dot.corruption.duration*1.3

actions.dots=seed_of_corruption,if=dot.corruption.remains<=action.seed_of_corruption.cast_time+time_to_shard+4.2*(1-talent.creeping_death.enabled*0.15)&spell_targets.seed_of_corruption_aoe>=3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&!dot.seed_of_corruption.remains&!action.seed_of_corruption.in_flight
actions.dots+=/agony,target_if=min:remains,if=talent.creeping_death.enabled&active_dot.agony<6&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
actions.dots+=/agony,target_if=min:remains,if=!talent.creeping_death.enabled&active_dot.agony<8&target.time_to_die>10&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)
actions.dots+=/siphon_life,target_if=min:remains,if=(active_dot.siphon_life<8-talent.creeping_death.enabled-spell_targets.sow_the_seeds_aoe)&target.time_to_die>10&refreshable&(!remains&spell_targets.seed_of_corruption_aoe=1|cooldown.summon_darkglare.remains>soul_shard*action.unstable_affliction.execute_time)
actions.dots+=/corruption,cycle_targets=1,if=spell_targets.seed_of_corruption_aoe<3+raid_event.invulnerable.up+talent.writhe_in_agony.enabled&(remains<=gcd|cooldown.summon_darkglare.remains>10&refreshable)&target.time_to_die>10

actions.fillers=unstable_affliction,line_cd=15,if=cooldown.deathbolt.remains<=gcd*2&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains>20
actions.fillers+=/call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&(dot.agony.remains<dot.agony.duration*0.75|dot.corruption.remains<dot.corruption.duration*0.75|dot.siphon_life.remains<dot.siphon_life.duration*0.75)&cooldown.deathbolt.remains<=action.agony.gcd*4&cooldown.summon_darkglare.remains>20
actions.fillers+=/call_action_list,name=db_refresh,if=talent.deathbolt.enabled&spell_targets.seed_of_corruption_aoe=1+raid_event.invulnerable.up&cooldown.summon_darkglare.remains<=soul_shard*action.agony.gcd+action.agony.gcd*3&(dot.agony.remains<dot.agony.duration*1|dot.corruption.remains<dot.corruption.duration*1|dot.siphon_life.remains<dot.siphon_life.duration*1)
actions.fillers+=/deathbolt,if=cooldown.summon_darkglare.remains>=30+gcd|cooldown.summon_darkglare.remains>140
actions.fillers+=/shadow_bolt,if=buff.movement.up&buff.nightfall.remains
actions.fillers+=/agony,if=buff.movement.up&!(talent.siphon_life.enabled&(prev_gcd.1.agony&prev_gcd.2.agony&prev_gcd.3.agony)|prev_gcd.1.agony)
actions.fillers+=/siphon_life,if=buff.movement.up&!(prev_gcd.1.siphon_life&prev_gcd.2.siphon_life&prev_gcd.3.siphon_life)
actions.fillers+=/corruption,if=buff.movement.up&!prev_gcd.1.corruption&!talent.absolute_corruption.enabled
actions.fillers+=/drain_life,if=(buff.inevitable_demise.stack>=85-(spell_targets.seed_of_corruption_aoe-raid_event.invulnerable.up>2)*20&(cooldown.deathbolt.remains>execute_time|!talent.deathbolt.enabled)&(cooldown.phantom_singularity.remains>execute_time|!talent.phantom_singularity.enabled)&(cooldown.dark_soul.remains>execute_time|!talent.dark_soul_misery.enabled)&(cooldown.vile_taint.remains>execute_time|!talent.vile_taint.enabled)&cooldown.summon_darkglare.remains>execute_time+10|buff.inevitable_demise.stack>30&target.time_to_die<=10)
actions.fillers+=/haunt
actions.fillers+=/drain_soul,interrupt_global=1,chain=1,interrupt=1,cycle_targets=1,if=target.time_to_die<=gcd
actions.fillers+=/drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains
actions.fillers+=/drain_soul,target_if=min:debuff.shadow_embrace.remains,chain=1,interrupt_if=ticks_remain<5,interrupt_global=1,if=talent.shadow_embrace.enabled&variable.maintain_se
actions.fillers+=/drain_soul,interrupt_global=1,chain=1,interrupt=1
actions.fillers+=/shadow_bolt,cycle_targets=1,if=talent.shadow_embrace.enabled&variable.maintain_se&!debuff.shadow_embrace.remains&!action.shadow_bolt.in_flight
actions.fillers+=/shadow_bolt,target_if=min:debuff.shadow_embrace.remains,if=talent.shadow_embrace.enabled&variable.maintain_se
actions.fillers+=/shadow_bolt

actions.spenders=unstable_affliction,if=cooldown.summon_darkglare.remains<=soul_shard*execute_time&(!talent.deathbolt.enabled|cooldown.deathbolt.remains<=soul_shard*execute_time)
actions.spenders+=/call_action_list,name=fillers,if=(cooldown.summon_darkglare.remains<time_to_shard*(6-soul_shard)|cooldown.summon_darkglare.up)&time_to_die>cooldown.summon_darkglare.remains
actions.spenders+=/seed_of_corruption,if=variable.use_seed
actions.spenders+=/unstable_affliction,if=!variable.use_seed&!prev_gcd.1.summon_darkglare&(talent.deathbolt.enabled&cooldown.deathbolt.remains<=execute_time&!azerite.cascading_calamity.enabled|(soul_shard>=5&spell_targets.seed_of_corruption_aoe<2|soul_shard>=2&spell_targets.seed_of_corruption_aoe>=2)&target.time_to_die>4+execute_time&spell_targets.seed_of_corruption_aoe=1|target.time_to_die<=8+execute_time*soul_shard)
actions.spenders+=/unstable_affliction,if=!variable.use_seed&contagion<=cast_time+variable.padding
actions.spenders+=/unstable_affliction,cycle_targets=1,if=!variable.use_seed&(!talent.deathbolt.enabled|cooldown.deathbolt.remains>time_to_shard|soul_shard>1)&(!talent.vile_taint.enabled|soul_shard>1)&contagion<=cast_time+variable.padding&(!azerite.cascading_calamity.enabled|buff.cascading_calamity.remains>time_to_shard)

head=visage_of_the_ascended_prophet,id=160719,bonus_id=4824/1507/4775,azerite_powers=483/21/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=mantle_of_contained_corruption,id=160613,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=ring_of_the_infinite_void,id=160647,bonus_id=4800/1507,enchant=pact_of_mastery
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_mastery
trinket1=balefire_branch,id=159630,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=masterful_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5205
# gear_crit_rating=802
# gear_haste_rating=1014
# gear_mastery_rating=1220
# gear_versatility_rating=129
# gear_armor=1165
default_pet=succubus

Simulation & Raid Information

Iterations: 25003
Threads: 4
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 496710242
Max Event Queue: 177
Sim Seconds: 7500943
CPU Seconds: 705.5313
Physical Seconds: 180.2448
Speed Up: 10632

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Deathbolt Deathbolt agony ticks -980 441422 1471 38.45 1972 3944 17.0 192.2 16.4% 0.0% 0.0% 0.0% 17.48sec 441422 300.00sec
Deathbolt Deathbolt augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Deathbolt Deathbolt corruption ticks -172 500651 1669 38.10 2256 4513 20.8 190.5 16.5% 0.0% 0.0% 0.0% 14.30sec 500651 300.00sec
Deathbolt Deathbolt dark_soul 113860 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 167.02sec 0 300.00sec
Deathbolt Deathbolt deathbolt 264106 332056 1107 1.98 28750 57384 9.9 9.9 16.6% 0.0% 0.0% 0.0% 30.77sec 332056 300.00sec
Deathbolt Deathbolt flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Deathbolt Deathbolt food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Deathbolt Deathbolt haunt 48181 158268 528 3.67 7402 14811 17.4 18.4 16.4% 0.0% 0.0% 0.0% 16.78sec 158268 300.00sec
Deathbolt Deathbolt heed_my_call 271685 47661 159 1.41 5802 11614 7.1 7.1 16.4% 0.0% 0.0% 0.0% 37.94sec 47661 300.00sec
Deathbolt Deathbolt heed_my_call_aoe 271686 20435 68 1.41 2487 4974 7.1 7.1 16.5% 0.0% 0.0% 0.0% 37.94sec 20435 300.00sec
Deathbolt Deathbolt phantom_singularity ticks -205179 330504 1102 14.08 4695 0 6.8 70.4 0.0% 0.0% 0.0% 0.0% 45.62sec 330504 300.00sec
Deathbolt Deathbolt potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Deathbolt Deathbolt shadow_bolt 232670 714510 2382 18.06 6793 13591 91.0 90.3 16.5% 0.0% 0.0% 0.0% 3.19sec 714510 300.00sec
Deathbolt Deathbolt siphon_life ticks -63106 446633 1489 25.50 3009 6018 19.3 127.5 16.4% 0.0% 0.0% 0.0% 15.55sec 446633 300.00sec
Deathbolt Deathbolt summon_darkglare 205180 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.27sec 0 300.00sec
Deathbolt Deathbolt summon_succubus 712 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Deathbolt Deathbolt unstable_affliction 30108 0 0 0.00 0 0 38.1 0.0 0.0% 0.0% 0.0% 0.0% 7.80sec 0 300.00sec
Deathbolt Deathbolt unstable_affliction_1 ticks -233490 595018 1983 24.97 4092 8184 0.0 124.8 16.5% 0.0% 0.0% 0.0% 0.00sec 595018 300.00sec
Deathbolt Deathbolt unstable_affliction_2 ticks -233496 227424 758 9.14 4275 8549 0.0 45.7 16.5% 0.0% 0.0% 0.0% 0.00sec 227424 300.00sec
Deathbolt Deathbolt unstable_affliction_3 ticks -233497 138742 462 5.42 4400 8804 0.0 27.1 16.4% 0.0% 0.0% 0.0% 0.00sec 138742 300.00sec
Deathbolt Deathbolt unstable_affliction_4 ticks -233498 94028 313 3.49 4625 9252 0.0 17.4 16.5% 0.0% 0.0% 0.0% 0.00sec 94028 300.00sec
Deathbolt Deathbolt unstable_affliction_5 ticks -233499 40475 135 1.46 4768 9536 0.0 7.3 16.5% 0.0% 0.0% 0.0% 0.00sec 40475 300.00sec
Deathbolt Deathbolt volatile_blood_explosion 278057 97681 326 1.39 12064 24126 7.1 7.0 16.5% 0.0% 0.0% 0.0% 37.86sec 97681 300.00sec
Deathbolt Deathbolt_darkglare dark_glare 205231 228395 5710 47.53 6187 12374 31.7 31.7 16.5% 0.0% 0.0% 0.0% 6.63sec 228395 40.00sec
Deathbolt Deathbolt_succubus lash_of_pain 7814 324672 1082 12.90 4323 8649 64.5 64.5 16.4% 0.0% 0.0% 0.0% 4.74sec 324672 300.00sec
Deathbolt Deathbolt_succubus melee 0 363751 1212 24.76 2523 5046 123.8 123.8 16.4% 0.0% 0.0% 0.0% 2.43sec 520026 300.00sec
Drain_Soul Drain_Soul agony ticks -980 440639 1469 38.43 1969 3940 16.0 192.1 16.4% 0.0% 0.0% 0.0% 18.61sec 440639 300.00sec
Drain_Soul Drain_Soul augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Drain_Soul Drain_Soul corruption ticks -172 498971 1663 38.07 2251 4504 20.1 190.3 16.4% 0.0% 0.0% 0.0% 14.71sec 498971 300.00sec
Drain_Soul Drain_Soul dark_soul 113860 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 168.76sec 0 300.00sec
Drain_Soul Drain_Soul drain_soul ticks -198590 817875 2726 36.94 3801 7606 66.8 184.7 16.5% 0.0% 0.0% 0.0% 4.39sec 817875 300.00sec
Drain_Soul Drain_Soul flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Drain_Soul Drain_Soul food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Drain_Soul Drain_Soul haunt 48181 157823 526 3.67 7390 14783 17.4 18.3 16.5% 0.0% 0.0% 0.0% 16.81sec 157823 300.00sec
Drain_Soul Drain_Soul heed_my_call 271685 47624 159 1.41 5796 11590 7.1 7.1 16.4% 0.0% 0.0% 0.0% 38.07sec 47624 300.00sec
Drain_Soul Drain_Soul heed_my_call_aoe 271686 20429 68 1.41 2484 4968 7.1 7.1 16.5% 0.0% 0.0% 0.0% 38.07sec 20429 300.00sec
Drain_Soul Drain_Soul phantom_singularity ticks -205179 329523 1098 14.01 4706 0 6.7 70.0 0.0% 0.0% 0.0% 0.0% 45.89sec 329523 300.00sec
Drain_Soul Drain_Soul potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Drain_Soul Drain_Soul siphon_life ticks -63106 444606 1482 25.52 2992 5983 18.9 127.6 16.5% 0.0% 0.0% 0.0% 15.73sec 444606 300.00sec
Drain_Soul Drain_Soul summon_darkglare 205180 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.54sec 0 300.00sec
Drain_Soul Drain_Soul summon_succubus 712 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Drain_Soul Drain_Soul unstable_affliction 30108 0 0 0.00 0 0 38.1 0.0 0.0% 0.0% 0.0% 0.0% 7.79sec 0 300.00sec
Drain_Soul Drain_Soul unstable_affliction_1 ticks -233490 507765 1693 21.21 4111 8222 0.0 106.0 16.5% 0.0% 0.0% 0.0% 0.00sec 507765 300.00sec
Drain_Soul Drain_Soul unstable_affliction_2 ticks -233496 330430 1101 13.68 4150 8300 0.0 68.4 16.4% 0.0% 0.0% 0.0% 0.00sec 330430 300.00sec
Drain_Soul Drain_Soul unstable_affliction_3 ticks -233497 97488 325 3.61 4635 9271 0.0 18.1 16.5% 0.0% 0.0% 0.0% 0.00sec 97488 300.00sec
Drain_Soul Drain_Soul unstable_affliction_4 ticks -233498 91557 305 3.40 4621 9241 0.0 17.0 16.4% 0.0% 0.0% 0.0% 0.00sec 91557 300.00sec
Drain_Soul Drain_Soul unstable_affliction_5 ticks -233499 60005 200 2.21 4678 9346 0.0 11.0 16.3% 0.0% 0.0% 0.0% 0.00sec 60005 300.00sec
Drain_Soul Drain_Soul volatile_blood_explosion 278057 97638 325 1.39 12051 24100 7.1 7.0 16.6% 0.0% 0.0% 0.0% 37.94sec 97638 300.00sec
Drain_Soul Drain_Soul_darkglare dark_glare 205231 229947 5749 47.43 6245 12488 31.6 31.6 16.5% 0.0% 0.0% 0.0% 6.71sec 229947 40.00sec
Drain_Soul Drain_Soul_succubus lash_of_pain 7814 324646 1082 12.90 4322 8644 64.5 64.5 16.4% 0.0% 0.0% 0.0% 4.74sec 324646 300.00sec
Drain_Soul Drain_Soul_succubus melee 0 363750 1212 24.76 2523 5045 123.8 123.8 16.5% 0.0% 0.0% 0.0% 2.43sec 520024 300.00sec
Nightfall Nightfall agony ticks -980 440736 1469 38.43 1970 3941 16.0 192.2 16.4% 0.0% 0.0% 0.0% 18.61sec 440736 300.00sec
Nightfall Nightfall augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Nightfall Nightfall corruption ticks -172 499539 1665 38.06 2254 4508 20.1 190.3 16.5% 0.0% 0.0% 0.0% 14.69sec 499539 300.00sec
Nightfall Nightfall dark_soul 113860 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 167.85sec 0 300.00sec
Nightfall Nightfall flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Nightfall Nightfall food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Nightfall Nightfall haunt 48181 158535 528 3.67 7408 14825 17.4 18.4 16.5% 0.0% 0.0% 0.0% 16.78sec 158535 300.00sec
Nightfall Nightfall heed_my_call 271685 47537 158 1.41 5800 11604 7.0 7.0 16.5% 0.0% 0.0% 0.0% 38.42sec 47537 300.00sec
Nightfall Nightfall heed_my_call_aoe 271686 20388 68 1.41 2486 4972 7.0 7.0 16.6% 0.0% 0.0% 0.0% 38.42sec 20388 300.00sec
Nightfall Nightfall phantom_singularity ticks -205179 329917 1100 14.02 4705 0 6.7 70.1 0.0% 0.0% 0.0% 0.0% 45.79sec 329917 300.00sec
Nightfall Nightfall potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Nightfall Nightfall shadow_bolt 232670 975131 3250 20.50 8168 16337 103.3 102.5 16.5% 0.0% 0.0% 0.0% 2.82sec 975131 300.00sec
Nightfall Nightfall siphon_life ticks -63106 444887 1483 25.53 2993 5986 18.9 127.6 16.4% 0.0% 0.0% 0.0% 15.73sec 444887 300.00sec
Nightfall Nightfall summon_darkglare 205180 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.03sec 0 300.00sec
Nightfall Nightfall summon_succubus 712 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Nightfall Nightfall unstable_affliction 30108 0 0 0.00 0 0 38.2 0.0 0.0% 0.0% 0.0% 0.0% 7.79sec 0 300.00sec
Nightfall Nightfall unstable_affliction_1 ticks -233490 511681 1706 21.39 4110 8218 0.0 106.9 16.4% 0.0% 0.0% 0.0% 0.00sec 511681 300.00sec
Nightfall Nightfall unstable_affliction_2 ticks -233496 328260 1094 13.57 4155 8310 0.0 67.8 16.4% 0.0% 0.0% 0.0% 0.00sec 328260 300.00sec
Nightfall Nightfall unstable_affliction_3 ticks -233497 97400 325 3.61 4637 9275 0.0 18.0 16.4% 0.0% 0.0% 0.0% 0.00sec 97400 300.00sec
Nightfall Nightfall unstable_affliction_4 ticks -233498 91072 304 3.38 4621 9242 0.0 16.9 16.5% 0.0% 0.0% 0.0% 0.00sec 91072 300.00sec
Nightfall Nightfall unstable_affliction_5 ticks -233499 58410 195 2.15 4671 9340 0.0 10.7 16.5% 0.0% 0.0% 0.0% 0.00sec 58410 300.00sec
Nightfall Nightfall volatile_blood_explosion 278057 97844 326 1.39 12060 24129 7.1 7.0 16.4% 0.0% 0.0% 0.0% 37.91sec 97844 300.00sec
Nightfall Nightfall_darkglare dark_glare 205231 229536 5738 47.41 6236 12482 31.6 31.6 16.4% 0.0% 0.0% 0.0% 6.70sec 229536 40.00sec
Nightfall Nightfall_succubus lash_of_pain 7814 324734 1082 12.90 4322 8645 64.5 64.5 16.5% 0.0% 0.0% 0.0% 4.74sec 324734 300.00sec
Nightfall Nightfall_succubus melee 0 363811 1213 24.76 2523 5045 123.8 123.8 16.5% 0.0% 0.0% 0.0% 2.43sec 520111 300.00sec
No_Talent No_Talent agony ticks -980 440863 1470 38.43 1970 3941 16.0 192.2 16.5% 0.0% 0.0% 0.0% 18.61sec 440863 300.00sec
No_Talent No_Talent augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
No_Talent No_Talent corruption ticks -172 499474 1665 38.05 2254 4508 20.1 190.3 16.5% 0.0% 0.0% 0.0% 14.69sec 499474 300.00sec
No_Talent No_Talent dark_soul 113860 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 167.99sec 0 300.00sec
No_Talent No_Talent flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
No_Talent No_Talent food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
No_Talent No_Talent haunt 48181 158444 528 3.68 7403 14809 17.4 18.4 16.4% 0.0% 0.0% 0.0% 16.76sec 158444 300.00sec
No_Talent No_Talent heed_my_call 271685 47490 158 1.41 5802 11602 7.0 7.0 16.5% 0.0% 0.0% 0.0% 38.23sec 47490 300.00sec
No_Talent No_Talent heed_my_call_aoe 271686 20332 68 1.41 2486 4973 7.0 7.0 16.4% 0.0% 0.0% 0.0% 38.23sec 20332 300.00sec
No_Talent No_Talent phantom_singularity ticks -205179 329642 1099 14.02 4703 0 6.7 70.1 0.0% 0.0% 0.0% 0.0% 45.81sec 329642 300.00sec
No_Talent No_Talent potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
No_Talent No_Talent shadow_bolt 232670 781615 2605 19.84 6764 13528 100.0 99.2 16.5% 0.0% 0.0% 0.0% 2.91sec 781615 300.00sec
No_Talent No_Talent siphon_life ticks -63106 444841 1483 25.53 2993 5986 18.9 127.6 16.5% 0.0% 0.0% 0.0% 15.73sec 444841 300.00sec
No_Talent No_Talent summon_darkglare 205180 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.17sec 0 300.00sec
No_Talent No_Talent summon_succubus 712 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
No_Talent No_Talent unstable_affliction 30108 0 0 0.00 0 0 38.1 0.0 0.0% 0.0% 0.0% 0.0% 7.80sec 0 300.00sec
No_Talent No_Talent unstable_affliction_1 ticks -233490 509154 1697 21.28 4109 8218 0.0 106.4 16.5% 0.0% 0.0% 0.0% 0.00sec 509154 300.00sec
No_Talent No_Talent unstable_affliction_2 ticks -233496 330308 1101 13.65 4154 8309 0.0 68.3 16.5% 0.0% 0.0% 0.0% 0.00sec 330308 300.00sec
No_Talent No_Talent unstable_affliction_3 ticks -233497 97423 325 3.61 4637 9269 0.0 18.0 16.4% 0.0% 0.0% 0.0% 0.00sec 97423 300.00sec
No_Talent No_Talent unstable_affliction_4 ticks -233498 91229 304 3.39 4621 9243 0.0 16.9 16.5% 0.0% 0.0% 0.0% 0.00sec 91229 300.00sec
No_Talent No_Talent unstable_affliction_5 ticks -233499 59086 197 2.17 4669 9344 0.0 10.9 16.5% 0.0% 0.0% 0.0% 0.00sec 59086 300.00sec
No_Talent No_Talent volatile_blood_explosion 278057 97727 326 1.39 12060 24129 7.1 7.0 16.4% 0.0% 0.0% 0.0% 37.94sec 97727 300.00sec
No_Talent No_Talent_darkglare dark_glare 205231 229622 5741 47.41 6240 12485 31.6 31.6 16.4% 0.0% 0.0% 0.0% 6.71sec 229622 40.00sec
No_Talent No_Talent_succubus lash_of_pain 7814 324591 1082 12.90 4321 8646 64.5 64.5 16.4% 0.0% 0.0% 0.0% 4.74sec 324591 300.00sec
No_Talent No_Talent_succubus melee 0 363626 1212 24.76 2523 5044 123.8 123.8 16.4% 0.0% 0.0% 0.0% 2.43sec 519847 300.00sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
65603.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.81% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.45% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.14% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.14%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.12% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.12%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.55% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 12.37% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:12.37%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.21% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.21%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 12.10% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:12.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.51% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.51%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.75% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Haunt 18.4 0.0 16.7sec 16.7sec 89.53% 0.00% 0.0(0.0) 17.5

Buff details

  • buff initial source:Deathbolt
  • cooldown name:buff_haunt
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • haunt_1:89.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48181
  • name:Haunt
  • tooltip:Taking $s2% increased damage from the Warlock. Haunt's cooldown will be reset on death.
  • description:A ghostly soul haunts the target, dealing $s1 Shadow damage and increasing your damage dealt to the target by $s2% for {$d=15 seconds}. If the target dies, Haunt's cooldown is reset.
  • max_stacks:0
  • duration:15.00
  • cooldown:15.00
  • default_chance:0.00%
Haunt 18.3 0.0 16.8sec 16.8sec 89.39% 0.00% 0.0(0.0) 17.4

Buff details

  • buff initial source:Drain_Soul
  • cooldown name:buff_haunt
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • haunt_1:89.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48181
  • name:Haunt
  • tooltip:Taking $s2% increased damage from the Warlock. Haunt's cooldown will be reset on death.
  • description:A ghostly soul haunts the target, dealing $s1 Shadow damage and increasing your damage dealt to the target by $s2% for {$d=15 seconds}. If the target dies, Haunt's cooldown is reset.
  • max_stacks:0
  • duration:15.00
  • cooldown:15.00
  • default_chance:0.00%
Haunt 18.4 0.0 16.7sec 16.7sec 89.59% 0.00% 0.0(0.0) 17.5

Buff details

  • buff initial source:Nightfall
  • cooldown name:buff_haunt
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • haunt_1:89.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48181
  • name:Haunt
  • tooltip:Taking $s2% increased damage from the Warlock. Haunt's cooldown will be reset on death.
  • description:A ghostly soul haunts the target, dealing $s1 Shadow damage and increasing your damage dealt to the target by $s2% for {$d=15 seconds}. If the target dies, Haunt's cooldown is reset.
  • max_stacks:0
  • duration:15.00
  • cooldown:15.00
  • default_chance:0.00%
Haunt 18.4 0.0 16.7sec 16.7sec 89.64% 0.00% 0.0(0.0) 17.5

Buff details

  • buff initial source:No_Talent
  • cooldown name:buff_haunt
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • haunt_1:89.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48181
  • name:Haunt
  • tooltip:Taking $s2% increased damage from the Warlock. Haunt's cooldown will be reset on death.
  • description:A ghostly soul haunts the target, dealing $s1 Shadow damage and increasing your damage dealt to the target by $s2% for {$d=15 seconds}. If the target dies, Haunt's cooldown is reset.
  • max_stacks:0
  • duration:15.00
  • cooldown:15.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 65603.83
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 24999
Mean 300.00
Minimum 240.01
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 24999
Mean 66156.52
Minimum 62952.59
Maximum 70663.19
Spread ( max - min ) 7710.61
Range [ ( max - min ) / 2 * 100% ] 5.83%
Standard Deviation 1303.2519
5th Percentile 64338.89
95th Percentile 68595.15
( 95th Percentile - 5th Percentile ) 4256.25
Mean Distribution
Standard Deviation 8.2427
95.00% Confidence Intervall ( 66140.37 - 66172.68 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1491
0.1 Scale Factor Error with Delta=300 14500
0.05 Scale Factor Error with Delta=300 57997
0.01 Scale Factor Error with Delta=300 1449908
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 6415
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 23550731 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3336 3336 3336
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n